Lus10018299 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10018299 pacid=23179366 polypeptide=Lus10018299 locus=Lus10018299.g ID=Lus10018299.BGIv1.0 annot-version=v1.0
ATGATGGGAACAGTCCTCAAGGACCAGCATCTGCGAATAGCCTCACCGAACTCGGTGAAGTCCTCCTCATTTCGAGCCATAGCAGTTGCCAATCGTTTGG
GAATCAACATCGAAGGCTACATTCTGATCACCTCGGCTTCAAATCCATTGTGCAGCTTCCTCCAAAGCAAGTGTGTCACCAATTTATTCATACTCCATAG
CCGTCTAAGTAATGGAAATGTATATATTGTTCACTCTAACTTGGGAAAAATAGCAACACGTTATTCAGTGGACAGTGCGATTTGGAGGGAGACTGGAAAG
CGCGGGAAAATGGTAGGGTTTAAGCTTATCTAG
AA sequence
>Lus10018299 pacid=23179366 polypeptide=Lus10018299 locus=Lus10018299.g ID=Lus10018299.BGIv1.0 annot-version=v1.0
MMGTVLKDQHLRIASPNSVKSSSFRAIAVANRLGINIEGYILITSASNPLCSFLQSKCVTNLFILHSRLSNGNVYIVHSNLGKIATRYSVDSAIWRETGK
RGKMVGFKLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10018299 0 1
AT2G44210 Protein of Unknown Function (D... Lus10005502 1.0 0.7195
AT5G65700 BAM1 BARELY ANY MERISTEM 1, Leucine... Lus10011577 5.5 0.6279
AT1G34050 Ankyrin repeat family protein ... Lus10026590 11.3 0.6000
Lus10029489 11.6 0.6171
AT4G35310 CPK5, ATCPK5 calmodulin-domain protein kina... Lus10016191 24.2 0.5464
AT3G26300 CYP71B34 "cytochrome P450, family 71, s... Lus10038796 31.8 0.5101
Lus10024734 37.8 0.5223
Lus10003442 44.0 0.5282
AT3G55700 UDP-Glycosyltransferase superf... Lus10040724 44.2 0.5117
AT4G35700 C2H2ZnF DAZ3 DUO1-activated zinc finger 3, ... Lus10041633 45.0 0.5117

Lus10018299 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.