Lus10018326 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25170 293 / 1e-101 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 268 / 2e-91 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 247 / 2e-83 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 259 / 6e-83 unknown protein
AT1G47740 228 / 4e-75 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 210 / 8e-69 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 205 / 5e-67 PPPDE putative thiol peptidase family protein (.1.2)
AT4G25680 94 / 2e-23 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 93 / 5e-23 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 65 / 1e-12 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017127 391 / 9e-141 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10005341 325 / 2e-114 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Lus10041021 319 / 4e-112 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1)
Lus10042454 246 / 9e-83 AT1G80690 265 / 1e-89 PPPDE putative thiol peptidase family protein (.1)
Lus10026215 244 / 6e-82 AT1G80690 265 / 8e-90 PPPDE putative thiol peptidase family protein (.1)
Lus10032708 227 / 3e-75 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 224 / 3e-74 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040170 216 / 2e-71 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040485 216 / 4e-71 AT1G47740 272 / 6e-92 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G261500 301 / 1e-104 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 297 / 3e-103 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.003G180400 263 / 6e-90 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
Potri.001G047800 255 / 6e-87 AT1G80690 298 / 2e-103 PPPDE putative thiol peptidase family protein (.1)
Potri.014G042300 234 / 3e-78 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.002G134200 233 / 1e-77 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 226 / 7e-75 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 222 / 2e-73 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 221 / 4e-73 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.003G080300 216 / 2e-71 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10018326 pacid=23179323 polypeptide=Lus10018326 locus=Lus10018326.g ID=Lus10018326.BGIv1.0 annot-version=v1.0
ATGTTGCCGCATAAGAAGAAGAAGGCGGGTTCGGTGCCGGTTTACTTGAATGTTTATGATTTGACACCCATGAATGGCTACGCTTACTGGGTCGGCCTTG
GAATCTACCACTCTGGCGTCCAAGTTCACGGAGTTGAATATGGATTTGGAGCTCATGATCATTCAACCACGGGGGTATTCGAGGTTGAACCGAAGCAGTG
CCCTGGTTTCACTTTCAGGAAATCGATACTCATCGGCAGAACTGATCTCGGTACGAAAGAAGTTCGTTCGATGATGGAGCAACTGGCCAAAGAGTATTCC
GGGAATGCCTACCACCTTATCACTAAGAACTGCAATCACTTCTGCAATGATGTCTGTGTCAAGCTAACTGGGAAAACCATTCCCAGCTGGGTTAACCGGC
TTGCTCGATTAGGTTTTCTTTGCAACTGCGTTCTTCCAGCAGAGCTGAATGGAGCGAAAGTCCGGCAAGTAAGATCGGGGGAGAGGGTGCAGCAAGTAGA
GAAGAAGAAGTTAAGGAGCCGTTCGAGTAGATTTGCATCTGCAACAACCAACACACCTACATTATCAAAAACTGCTTCAGGTTCTGCAATCAGTGGTCGT
GCTGGACAGAACTTGTGA
AA sequence
>Lus10018326 pacid=23179323 polypeptide=Lus10018326 locus=Lus10018326.g ID=Lus10018326.BGIv1.0 annot-version=v1.0
MLPHKKKKAGSVPVYLNVYDLTPMNGYAYWVGLGIYHSGVQVHGVEYGFGAHDHSTTGVFEVEPKQCPGFTFRKSILIGRTDLGTKEVRSMMEQLAKEYS
GNAYHLITKNCNHFCNDVCVKLTGKTIPSWVNRLARLGFLCNCVLPAELNGAKVRQVRSGERVQQVEKKKLRSRSSRFASATTNTPTLSKTASGSAISGR
AGQNL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G25170 PPPDE putative thiol peptidase... Lus10018326 0 1
AT3G03750 SUVR3, SDG20 SET domain protein 20 (.1.2) Lus10003864 5.3 0.7528
AT1G64280 SAI1, NIM1, NPR... SALICYLIC ACID INSENSITIVE 1, ... Lus10018756 8.2 0.7793
AT4G39100 SHL1 short life, PHD finger family ... Lus10028801 8.7 0.7483
AT5G25170 PPPDE putative thiol peptidase... Lus10017127 9.7 0.6910
AT3G05290 AtPNC1, PNC1 peroxisomal adenine nucleotide... Lus10010517 13.4 0.7770
AT5G13640 PDAT1, ATPDAT PHOSPHOLIPID:DIACYLGLYCEROL AC... Lus10015639 13.5 0.7252
AT3G18165 MOS4 modifier of snc1,4 (.1) Lus10041997 22.8 0.7448
AT5G12410 THUMP domain-containing protei... Lus10005018 22.8 0.7528
AT5G13570 TDT, DCP2, ATDC... TRIDENT, decapping 2 (.1.2) Lus10023516 24.0 0.7438
AT5G52030 TraB family protein (.1.2) Lus10015005 24.7 0.7157

Lus10018326 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.