Lus10018330 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32070 444 / 3e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 424 / 1e-151 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT5G10960 418 / 5e-149 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 349 / 1e-121 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT3G44260 284 / 3e-96 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G22250 279 / 4e-94 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G06450 165 / 1e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 129 / 1e-35 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44240 122 / 1e-33 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 118 / 2e-31 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017123 566 / 0 AT2G32070 447 / 1e-160 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10003635 427 / 2e-152 AT2G32070 435 / 6e-156 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10036291 426 / 3e-152 AT2G32070 432 / 9e-155 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10034180 292 / 2e-99 AT5G22250 410 / 4e-146 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10004212 278 / 1e-93 AT3G44260 336 / 1e-116 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10021304 278 / 1e-93 AT5G22250 335 / 8e-116 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10016980 275 / 4e-91 AT5G22250 332 / 8e-114 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10007771 157 / 3e-46 AT1G61470 170 / 5e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10042746 157 / 7e-46 AT5G10960 150 / 2e-43 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G262500 494 / 4e-179 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 491 / 4e-178 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G046700 473 / 7e-171 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 469 / 4e-169 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.006G187200 394 / 2e-139 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 298 / 1e-101 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 287 / 3e-97 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 281 / 1e-94 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G205600 275 / 3e-92 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.001G040400 234 / 1e-76 AT5G22250 253 / 4e-84 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10018330 pacid=23179284 polypeptide=Lus10018330 locus=Lus10018330.g ID=Lus10018330.BGIv1.0 annot-version=v1.0
ATGTCGATCATGTCGAAAGGTGATGAGTCTATCCATATTCGGGAGGTGTGGAATGACAATCTGGAAGAGGAATTCGCTTTGATTCGTGAGGTTGTTGACC
TGTTCCCTTTTGTTGCGATGGATACTGAGTTCCCTGGTGTGGTCCTGCGACCTGTAGTGGTTTACAAGAACATCAATGATTACAACTACCTGACGTTGAA
GGCTAATGTGGATATGCTGAAATTGATCCAGTTGGGGCTCACTTTCTCGGACGACAAGGGGAATTTGCCCACTTGCGGAACCGATGATGATAGGTTCTGC
ATTTGGCAGTTCAACTTCCGCGAGTTCAATGTCACAGAGGACATCTATGCTAGCGACTCGATTGAGCTGCTGCGCCAGTGTGGGATTGATTTCAAGAAGA
ACAACGAAAGGGGTATCGACGTCAGCCGGTTTGGTGAGCTTCTGATGTCCTCAGGGATTGTATTGAACCCTGAGGTGCATTGGGTTACTTTCCACAGTGG
GTATGATTTCGGCTACTTGCTCAAGCTCTTGACATGCAAGAGCCTTCCAGACACTCAAGCTGGATTCTTCGACCTGATCAATATGTATTTCCCGATGGTG
TATGACATCAAGCACTTGATGAAGTTCTGCAACAACCTCCATGGCGGCTTGAACAAACTTGCCGAGTTGCTGGAGGTCGAAAGAGTCGGTGTTTGCCATC
AAGCTGGGTCGGATAGCTTGCTCACATCATGCACGTTTAGGAAGTTGAGGGATAATTACTTCAGCGGTTCAACAGAGAAGTATGCTGGTGTGTTGTATGG
TCTTGGTATTGATAATGGCCAAAATACTAATTGA
AA sequence
>Lus10018330 pacid=23179284 polypeptide=Lus10018330 locus=Lus10018330.g ID=Lus10018330.BGIv1.0 annot-version=v1.0
MSIMSKGDESIHIREVWNDNLEEEFALIREVVDLFPFVAMDTEFPGVVLRPVVVYKNINDYNYLTLKANVDMLKLIQLGLTFSDDKGNLPTCGTDDDRFC
IWQFNFREFNVTEDIYASDSIELLRQCGIDFKKNNERGIDVSRFGELLMSSGIVLNPEVHWVTFHSGYDFGYLLKLLTCKSLPDTQAGFFDLINMYFPMV
YDIKHLMKFCNNLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDNYFSGSTEKYAGVLYGLGIDNGQNTN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32070 Polynucleotidyl transferase, r... Lus10018330 0 1
AT3G07170 Sterile alpha motif (SAM) doma... Lus10011841 4.2 0.9360
AT1G11905 B-cell receptor-associated pro... Lus10000048 4.2 0.9458
AT1G68300 Adenine nucleotide alpha hydro... Lus10041436 6.6 0.9421
AT5G49710 unknown protein Lus10000765 7.5 0.9461
AT1G78895 Reticulon family protein (.1) Lus10033352 8.1 0.9402
AT3G57870 SCE1A, SCE1, AH... SUMO CONJUGATING ENZYME 1A, EM... Lus10009376 8.1 0.9434
AT3G62420 bZIP ATBZIP53 basic region/leucine zipper mo... Lus10025024 12.6 0.9221
AT4G14440 HCD1, ATECI3 DELTA\(3\), DELTA\(2\)-ENOYL C... Lus10041154 12.8 0.9166
AT1G11905 B-cell receptor-associated pro... Lus10020025 13.2 0.9388
Lus10006539 13.4 0.9284

Lus10018330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.