Lus10018340 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G58170 129 / 5e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 123 / 1e-35 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13650 122 / 2e-35 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13660 118 / 1e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 115 / 2e-32 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G58090 115 / 7e-32 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 111 / 3e-31 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT1G22900 111 / 7e-31 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13662 110 / 9e-31 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 109 / 2e-30 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016231 183 / 3e-59 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10029312 168 / 2e-53 AT3G13660 135 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10026176 133 / 1e-39 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10042488 132 / 5e-39 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10029306 122 / 3e-35 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10030483 117 / 2e-33 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10000376 115 / 3e-33 AT5G42510 87 / 1e-22 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017231 110 / 1e-30 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 110 / 7e-30 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G216300 149 / 1e-45 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G216400 146 / 1e-44 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 135 / 2e-40 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 129 / 4e-38 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G009100 129 / 7e-38 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216200 126 / 6e-37 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.006G195300 126 / 9e-37 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023800 124 / 4e-36 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.009G131000 123 / 1e-35 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060801 120 / 1e-34 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10018340 pacid=23179273 polypeptide=Lus10018340 locus=Lus10018340.g ID=Lus10018340.BGIv1.0 annot-version=v1.0
ATGGCTTCTTACAACCCATCTATCACCGCCGGCGCCCTTTTCACAATCATAATCATCACCTCAATCACGACCATCAACCACGTCAACGCCACCTCACCCA
ACGAGATGATGAAGCTGACCCACATCCGCGCCTACTGGCAGAACGACAACAATGCCACGGCGGTTGTCTCCGTCTCTCCTTTGCCGGCCGACGACCCTTT
TGCCTTCGGCTCCATAAGCATCACGGACGACCCTCTGACCGTGGGCCCCATCCGCGGGTCCACTTTGATGGGCCGAGCCCAAGGCTTTTACGCTTCTACG
GGCCAGAACGCTTTCGCCCTTCTGATGGCTATGAACTTTGTGTTCCTCGACGAGAAATTAAACGGCAGTAGAGTCACCATTTTGGGAAAGAATGAAGTTC
CGATGAAGGTGAGGGAGATGTCGGTGGTCGGCGGCACCAGAGTATATCGGATGGCTAAGGGTTTTGCTCTTTTTAATACTTATTTCTTTGACCCCGTAGC
TGCAATCGCCGTCGTCAAATATAACATTTATATATGGCATTATTAG
AA sequence
>Lus10018340 pacid=23179273 polypeptide=Lus10018340 locus=Lus10018340.g ID=Lus10018340.BGIv1.0 annot-version=v1.0
MASYNPSITAGALFTIIIITSITTINHVNATSPNEMMKLTHIRAYWQNDNNATAVVSVSPLPADDPFAFGSISITDDPLTVGPIRGSTLMGRAQGFYAST
GQNAFALLMAMNFVFLDEKLNGSRVTILGKNEVPMKVREMSVVGGTRVYRMAKGFALFNTYFFDPVAAIAVVKYNIYIWHY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G58170 Disease resistance-responsive ... Lus10018340 0 1
AT1G54710 ATATG18H homolog of yeast autophagy 18 ... Lus10000925 4.9 0.8626
AT5G54080 HGO "homogentisate 1,2-dioxygenase... Lus10042839 10.2 0.8569
AT4G13980 HSF AT-HSFA5 HEAT SHOCK TRANSCRIPTION FACTO... Lus10022546 11.0 0.8584
AT4G31450 RING/U-box superfamily protein... Lus10020145 12.8 0.8825
AT5G57580 Calmodulin-binding protein (.1... Lus10001436 14.6 0.8798
AT3G61800 unknown protein Lus10004000 19.3 0.8614
AT1G23780 F-box family protein (.1) Lus10006139 20.9 0.8417
AT3G01650 RGLG1 RING domain ligase1 (.1) Lus10032097 26.2 0.8421
AT1G54610 Protein kinase superfamily pro... Lus10004144 29.1 0.8460
AT3G56320 PAP/OAS1 substrate-binding dom... Lus10029045 41.7 0.8576

Lus10018340 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.