Lus10018346 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21870 118 / 4e-35 HSP20-like chaperones superfamily protein (.1)
AT1G53540 72 / 7e-17 HSP20-like chaperones superfamily protein (.1)
AT1G07400 69 / 2e-15 HSP20-like chaperones superfamily protein (.1)
AT1G59860 66 / 2e-14 HSP20-like chaperones superfamily protein (.1)
AT5G12030 61 / 2e-12 AT-HSP17.6A heat shock protein 17.6A (.1)
AT5G12020 61 / 3e-12 HSP17.6II 17.6 kDa class II heat shock protein (.1)
AT5G37670 57 / 3e-11 HSP15.7CI HSP20-like chaperones superfamily protein (.1)
AT3G46230 54 / 7e-10 ATHSP17.4 ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4 (.1)
AT2G29500 53 / 2e-09 HSP20-like chaperones superfamily protein (.1)
AT1G54050 52 / 2e-09 HSP20-like chaperones superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007666 255 / 3e-89 AT4G21870 122 / 2e-36 HSP20-like chaperones superfamily protein (.1)
Lus10026262 66 / 6e-14 AT4G10250 152 / 5e-47 HSP20-like chaperones superfamily protein (.1)
Lus10042408 66 / 8e-14 AT4G10250 154 / 1e-47 HSP20-like chaperones superfamily protein (.1)
Lus10009085 58 / 3e-11 AT1G53540 232 / 2e-79 HSP20-like chaperones superfamily protein (.1)
Lus10040723 57 / 9e-11 AT2G29500 219 / 3e-74 HSP20-like chaperones superfamily protein (.1)
Lus10040722 55 / 4e-10 AT1G07400 214 / 2e-72 HSP20-like chaperones superfamily protein (.1)
Lus10016456 53 / 2e-09 AT1G07400 213 / 8e-72 HSP20-like chaperones superfamily protein (.1)
Lus10016458 53 / 2e-09 AT2G29500 214 / 3e-72 HSP20-like chaperones superfamily protein (.1)
Lus10016457 53 / 2e-09 AT1G07400 216 / 4e-73 HSP20-like chaperones superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G001600 143 / 7e-45 AT4G21870 155 / 1e-49 HSP20-like chaperones superfamily protein (.1)
Potri.019G081250 73 / 5e-17 AT2G29500 182 / 6e-60 HSP20-like chaperones superfamily protein (.1)
Potri.009G049900 71 / 3e-16 AT2G29500 154 / 2e-48 HSP20-like chaperones superfamily protein (.1)
Potri.004G187450 71 / 4e-16 AT2G29500 221 / 5e-75 HSP20-like chaperones superfamily protein (.1)
Potri.004G187400 70 / 8e-16 AT1G07400 193 / 7e-64 HSP20-like chaperones superfamily protein (.1)
Potri.009G147900 69 / 1e-15 AT2G29500 193 / 5e-64 HSP20-like chaperones superfamily protein (.1)
Potri.009G148000 69 / 1e-15 AT2G29500 190 / 7e-63 HSP20-like chaperones superfamily protein (.1)
Potri.009G049800 69 / 2e-15 AT2G29500 152 / 4e-48 HSP20-like chaperones superfamily protein (.1)
Potri.004G187202 68 / 3e-15 AT2G29500 209 / 1e-70 HSP20-like chaperones superfamily protein (.1)
Potri.009G039200 66 / 3e-14 AT1G07400 201 / 3e-67 HSP20-like chaperones superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0190 HSP20 PF00011 HSP20 Hsp20/alpha crystallin family
Representative CDS sequence
>Lus10018346 pacid=23162100 polypeptide=Lus10018346 locus=Lus10018346.g ID=Lus10018346.BGIv1.0 annot-version=v1.0
ATGGATTTCTCTCCCTATCATTCGTCTCCATGGCAATATCTCATTGCTCCCACCGGCGGCGTTCCCCATTCCTTAGCTGTCCCTGCCAATTACGTCCACT
GGACTCAGAACCCCAACTCCCAGATTTTCTCCGCCGACATCCCCGGGGTGAGGAAAGAGGATATAAGAGTGGAGGTGGAGAACTCCAGATATCTGATTAT
CTGGACGGACGGGTCAAATATCCCGCCGGAGAGGAGTTTCATGAGGAAATTCCGGCTGCCGGACTTGGTCTACGTGGACGGGATATCAGCTGCGTACGAA
GATGGTGTGTTGAAGGTCACCGTCCCTAGAGCTTCCAGAAGGATAGGAGTCTTCATTCACCCCGCTGACGTGCCGGAAAGATTGGACTGTCTGGCTCCGG
CTGCTTGA
AA sequence
>Lus10018346 pacid=23162100 polypeptide=Lus10018346 locus=Lus10018346.g ID=Lus10018346.BGIv1.0 annot-version=v1.0
MDFSPYHSSPWQYLIAPTGGVPHSLAVPANYVHWTQNPNSQIFSADIPGVRKEDIRVEVENSRYLIIWTDGSNIPPERSFMRKFRLPDLVYVDGISAAYE
DGVLKVTVPRASRRIGVFIHPADVPERLDCLAPAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G21870 HSP20-like chaperones superfam... Lus10018346 0 1
AT3G59310 Eukaryotic protein of unknown ... Lus10004060 1.7 0.8387
AT3G18715 IDL4 inflorescence deficient in abs... Lus10033523 2.0 0.8054
AT3G08710 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredo... Lus10029090 6.0 0.6737
AT3G19620 Glycosyl hydrolase family prot... Lus10002127 10.4 0.7851
AT2G20710 Tetratricopeptide repeat (TPR)... Lus10005600 11.5 0.6157
AT5G02920 F-box/RNI-like superfamily pro... Lus10035325 13.4 0.7621
AT1G67680 SRP72 RNA-binding domain (.1) Lus10036924 14.4 0.7138
Lus10021851 16.3 0.7591
Lus10012440 17.8 0.7591
AT1G02520 MDR8, ABCB11, P... multi-drug resistance 8, ATP-b... Lus10004530 19.3 0.7591

Lus10018346 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.