Lus10018362 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G04900 72 / 3e-16 RIC10 ROP-interactive CRIB motif-containing protein 10 (.1)
AT4G21745 71 / 7e-16 PAK-box/P21-Rho-binding family protein (.1)
AT4G28556 66 / 1e-13 RIC7 PAK-box/P21-Rho-binding family protein (.1)
AT1G03982 64 / 5e-13 PAK-box/P21-Rho-binding family protein (.1)
AT2G33460 63 / 3e-12 RIC1 ROP-interactive CRIB motif-containing protein 1 (.1)
AT2G20430 62 / 5e-12 RIC6 ROP-interactive CRIB motif-containing protein 6 (.1)
AT1G04450 61 / 2e-11 RIC3 ROP-interactive CRIB motif-containing protein 3 (.1)
AT3G23380 59 / 6e-11 RIC5 ROP-interactive CRIB motif-containing protein 5 (.1)
AT1G61795 54 / 1e-09 PAK-box/P21-Rho-binding family protein (.1)
AT1G27380 39 / 0.0003 RIC2 ROP-interactive CRIB motif-containing protein 2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007648 229 / 1e-77 AT4G04900 88 / 2e-22 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10006763 110 / 9e-31 AT4G04900 81 / 2e-19 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10011805 71 / 7e-15 AT2G33460 97 / 2e-24 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10020060 69 / 2e-14 AT3G54200 72 / 4e-15 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Lus10021168 67 / 2e-13 AT2G33460 81 / 3e-17 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10003625 61 / 1e-11 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
Lus10008243 59 / 4e-11 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
Lus10021974 40 / 0.0002 AT2G33460 51 / 4e-08 ROP-interactive CRIB motif-containing protein 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G025300 127 / 1e-37 AT4G04900 89 / 5e-23 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.004G020650 120 / 3e-35 AT4G04900 73 / 1e-16 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.002G035500 78 / 1e-17 AT2G20430 105 / 1e-27 ROP-interactive CRIB motif-containing protein 6 (.1)
Potri.010G069500 75 / 2e-16 AT4G28556 99 / 1e-24 PAK-box/P21-Rho-binding family protein (.1)
Potri.005G227500 72 / 2e-15 AT4G28556 106 / 5e-28 PAK-box/P21-Rho-binding family protein (.1)
Potri.008G168900 69 / 2e-14 AT2G33460 101 / 4e-26 ROP-interactive CRIB motif-containing protein 1 (.1)
Potri.002G233400 51 / 5e-08 AT5G16490 89 / 1e-22 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.014G147000 41 / 0.0001 AT5G16490 76 / 8e-18 ROP-interactive CRIB motif-containing protein 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00786 PBD P21-Rho-binding domain
Representative CDS sequence
>Lus10018362 pacid=23162182 polypeptide=Lus10018362 locus=Lus10018362.g ID=Lus10018362.BGIv1.0 annot-version=v1.0
ATGGGAACCAACAAGATTAAAGGGATCTACAAGGGTTTCAAGTTCATCACCCAAATCTTTGTTGTGAAGGAGAGGGAGTTGGAAATTGGGTACCCAACTG
ATGTTAAACATGTTGCTCATATTGGTTGGGATGGTGCCTCTGGTAATCCACCCAGCTGGATGAGTGAGTACAAAACAGCTCCTGAATTCTCCTCCTCAAA
GACTTTCAATAATGGTGGAAACCCAAGAGAGTCCAATTCAACGTCCTTGTCTCCATGGTCCTCTCAAGATTTTAGTGAATCAATGGGACTCCATCAGCTT
CCAGGATCAAGCATGTTTGAACAGAACATTCCCAATTCAGACCCACCAAACATCCCAAAGAAACACAAGAGGAAGAAGAAGACTTCTTCAACATCAGCAT
CAACAATTTCTCCTCCTAAAGGTTCAACATCATCGTCGCCTCCAATGACTTCTTCTTCCTTGACCAAGCCCTTTCGTTCTTCAAAGAAGAAAGCAATGTA
CCACGAGCTAGAGCACCAGACTGTGAACGTGCAAGCATAG
AA sequence
>Lus10018362 pacid=23162182 polypeptide=Lus10018362 locus=Lus10018362.g ID=Lus10018362.BGIv1.0 annot-version=v1.0
MGTNKIKGIYKGFKFITQIFVVKERELEIGYPTDVKHVAHIGWDGASGNPPSWMSEYKTAPEFSSSKTFNNGGNPRESNSTSLSPWSSQDFSESMGLHQL
PGSSMFEQNIPNSDPPNIPKKHKRKKKTSSTSASTISPPKGSTSSSPPMTSSSLTKPFRSSKKKAMYHELEHQTVNVQA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G04900 RIC10 ROP-interactive CRIB motif-con... Lus10018362 0 1
AT4G17150 alpha/beta-Hydrolases superfam... Lus10039125 1.0 0.8418
AT1G53035 unknown protein Lus10018600 1.7 0.8236
Lus10017544 2.0 0.8256
AT4G39870 TLD-domain containing nucleola... Lus10024053 4.7 0.7831
AT3G46060 ARA3, Ara-3, At... RAB GTPase homolog 8A (.1.2.3) Lus10004944 6.0 0.7981
AT2G37960 unknown protein Lus10027749 7.7 0.7687
AT5G08630 DDT domain-containing protein ... Lus10039626 8.8 0.7962
AT5G02440 unknown protein Lus10023770 9.0 0.7847
AT2G20410 RNA-binding ASCH domain protei... Lus10042558 11.2 0.7780
AT1G69580 GARP Homeodomain-like superfamily p... Lus10037169 13.7 0.7704

Lus10018362 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.