Lus10018369 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G05230 143 / 5e-44 Ubiquitin-like superfamily protein (.1)
AT4G03370 83 / 7e-20 Ubiquitin family protein (.1)
AT4G02950 71 / 2e-15 CRRJ Ubiquitin family protein (.1)
AT4G03360 71 / 2e-15 Ubiquitin family protein (.1)
AT4G03350 67 / 4e-14 EVE1 ETERNALLY VEGETATIVE PHASE 1, ubiquitin family protein (.1)
AT2G32350 61 / 3e-12 Ubiquitin-like superfamily protein (.1)
AT4G05310 54 / 2e-09 Ubiquitin-like superfamily protein (.1)
AT4G05260 47 / 4e-07 Ubiquitin-like superfamily protein (.1)
AT4G02970 45 / 3e-06 AT7SL-1 7SL RNA1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007641 218 / 1e-72 AT4G05230 145 / 1e-42 Ubiquitin-like superfamily protein (.1)
Lus10039679 55 / 8e-10 AT2G32350 239 / 1e-79 Ubiquitin-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G022400 143 / 2e-43 AT4G05230 144 / 1e-42 Ubiquitin-like superfamily protein (.1)
Potri.017G037600 62 / 2e-12 AT2G32350 294 / 4e-101 Ubiquitin-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10018369 pacid=23162114 polypeptide=Lus10018369 locus=Lus10018369.g ID=Lus10018369.BGIv1.0 annot-version=v1.0
ATGGACGGGATCGCGGTCAACAGGCTGGTCGTTCAATCCAACGGCGGATCCGAGCTCCACGATAACCTGACATTACGAGACTTACGATCTCATCGACAAC
AGCGCGGTCTTCGTCCTCAGACCGGATTGTCGTCGAAGAAGATGAAGCTGCTGGTGCTGACCAAGAGCGGGACCAAGAAAGTTCCCGTGGAGGTGAACGC
AGGGGATAATGTTGGGGAGCTGAGAAAGGAATTACAGAGGATGCAGCAGAAGCTTCAGTTTCCTCTGCCGCAAGAAGGGTATTTTTTCATATATAAACAG
AATGTCATGGAAGACGACCAGTCGTTTCGTTGGCACCATGTTGGCCATGGGGATACCATTGAGATCTTCAATGGTAGTGTTACTGGTGGATCGTAA
AA sequence
>Lus10018369 pacid=23162114 polypeptide=Lus10018369 locus=Lus10018369.g ID=Lus10018369.BGIv1.0 annot-version=v1.0
MDGIAVNRLVVQSNGGSELHDNLTLRDLRSHRQQRGLRPQTGLSSKKMKLLVLTKSGTKKVPVEVNAGDNVGELRKELQRMQQKLQFPLPQEGYFFIYKQ
NVMEDDQSFRWHHVGHGDTIEIFNGSVTGGS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G05230 Ubiquitin-like superfamily pro... Lus10018369 0 1
AT1G54870 NAD(P)-binding Rossmann-fold s... Lus10034048 4.2 0.7577
AT2G40190 LEW3 LEAF WILTING 3, UDP-Glycosyltr... Lus10031614 14.5 0.6870
AT5G23510 unknown protein Lus10029154 20.9 0.7171
AT3G56710 SIB1 sigma factor binding protein 1... Lus10026165 23.0 0.7202
AT1G69930 ATGSTU11 glutathione S-transferase TAU ... Lus10029518 27.7 0.6845
Lus10036765 34.5 0.6921
AT5G15630 IRX6, COBL4 IRREGULAR XYLEM 6, COBRA-LIKE4... Lus10021142 37.8 0.6921
AT2G16190 unknown protein Lus10011284 40.8 0.6921
AT3G54200 Late embryogenesis abundant (L... Lus10031554 43.6 0.6921
Lus10006395 46.3 0.6921

Lus10018369 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.