Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05230 61 / 2e-12 Ubiquitin-like superfamily protein (.1) AT4G02970 59 / 2e-11 AT7SL-1 7SL RNA1 (.1) AT4G03370 55 / 4e-10 Ubiquitin family protein (.1) AT4G03350 54 / 9e-10 EVE1 ETERNALLY VEGETATIVE PHASE 1, ubiquitin family protein (.1) AT4G05260 53 / 2e-09 Ubiquitin-like superfamily protein (.1) AT4G05310 53 / 3e-09 Ubiquitin-like superfamily protein (.1) AT4G05270 50 / 4e-09 Ubiquitin-like superfamily protein (.1) AT4G05240 52 / 5e-09 Ubiquitin-like superfamily protein (.1) AT4G05250 51 / 1e-08 Ubiquitin-like superfamily protein (.1) AT5G37640 38 / 0.0005 UBQ9 ubiquitin 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007641 [exp] 159 / 1e-49 AT4G05230 145 / 1e-42 Ubiquitin-like superfamily protein (.1) Lus10021830 [exp] 39 / 0.0003 AT5G42220 595 / 0.0 Ubiquitin-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G022400 [exp] 84 / 6e-21 AT4G05230 144 / 1e-42 Ubiquitin-like superfamily protein (.1) Potri.006G045300 [exp] 43 / 5e-06 AT4G05050 54 / 7e-10 ubiquitin 11 (.1.2.3.4) Potri.002G062500 [exp] 37 / 0.0005 AT1G31340 296 / 9e-105 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) Potri.005G096700 [exp] 37 / 0.0006 AT1G31340 270 / 2e-94 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00240 [flax] [poplar] ubiquitin Ubiquitin family
Representative CDS sequence Show only first row Show all	>Lus10018370 pacid=23162084 polypeptide=Lus10018370 locus=Lus10018370.g ID=Lus10018370.BGIv1.0 annot-version=v1.0 ATGCTCCGTCAATCTTCCTCAAGCCGCTGGAAATGGACGTCCACATTGTCACCAAGGGGGGGGCCGCCGTTCTCGATTGAAATCTGGTACTTCGACACCG TTTCGGAGATCAAGAAGAAGATGCACAAGTCCAAAGGCATCCCTATCAACAGACAAACGCTCTTCCTCAACGGCCAATTGCTCCTCGACGAGCACGACAC TGTCCACCACCACATCCTCCAAGACTCGCCCATCCAGCTCCACGTGTCACCCTCAGATCCCTCCGCCGTCGATGTTAAACCGACGATCATTACCTCCTCC GCCGCCGATTACCAACCACAATAA
AA sequence Show only first row Show all	>Lus10018370 pacid=23162084 polypeptide=Lus10018370 locus=Lus10018370.g ID=Lus10018370.BGIv1.0 annot-version=v1.0 MLRQSSSSRWKWTSTLSPRGGPPFSIEIWYFDTVSEIKKKMHKSKGIPINRQTLFLNGQLLLDEHDTVHHHILQDSPIQLHVSPSDPSAVDVKPTIITSS AADYQPQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02970		AT7SL-1	7SL RNA1 (.1)		Lus10018370 [exp]	0	1
AT5G50670	SBP	SPL13B	SQUAMOSA PROMOTER-BINDING PROT...		Lus10015764 [exp]	4.5	0.8503
					Lus10023803 [exp]	6.2	0.8534
AT4G09900		ATMES12	ARABIDOPSIS THALIANA METHYL ES...		Lus10009489 [exp]	16.1	0.8365
AT3G15010			RNA-binding (RRM/RBD/RNP motif...		Lus10021035 [exp]	16.6	0.8391
AT2G39440			unknown protein		Lus10040607 [exp]	20.5	0.8405
AT3G21220		ATMAP2K_ALPHA, ...	ARABIDOPSIS THALIANA MITOGEN-A...		Lus10028999 [exp]	21.8	0.7437
AT3G44900		ATCHX4	cation/H+ exchanger 4, cation/...		Lus10032621 [exp]	24.4	0.8317
AT4G04350		EMB2369	EMBRYO DEFECTIVE 2369, tRNA sy...		Lus10020041 [exp]	27.7	0.8126
					Lus10027893 [exp]	28.7	0.8044
AT5G06800	GARP		myb-like HTH transcriptional r...		Lus10023816 [exp]	30.9	0.8155

Compare expression of checked genes

Lus10018370 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.