Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05220 152 / 3e-46 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT1G61760 144 / 4e-43 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G01410 73 / 8e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35460 66 / 4e-13 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35980 61 / 3e-11 NHL10, YLS9, ATNHL10 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G06320 55 / 2e-09 NHL3 NDR1/HIN1-like 3 (.1) AT3G11650 55 / 3e-09 NHL2 NDR1/HIN1-like 2 (.1) AT5G06330 54 / 3e-09 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G53730 50 / 8e-08 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G52470 49 / 2e-07 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007636 [exp] 229 / 9e-78 AT4G05220 97 / 2e-25 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10006755 [exp] 206 / 5e-68 AT4G05220 145 / 9e-44 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10020065 [exp] 203 / 7e-67 AT4G05220 135 / 1e-39 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10020066 [exp] 151 / 6e-46 AT4G05220 261 / 6e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10006754 [exp] 149 / 3e-45 AT4G05220 263 / 3e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021287 [exp] 67 / 1e-13 AT2G35980 236 / 7e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021288 [exp] 66 / 3e-13 AT2G35980 237 / 2e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016962 [exp] 61 / 2e-11 AT2G35980 237 / 3e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021284 [exp] 58 / 4e-10 AT3G52460 164 / 1e-48 hydroxyproline-rich glycoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G027400 [exp] 151 / 5e-46 AT4G05220 264 / 8e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G023300 [exp] 150 / 7e-46 AT4G05220 276 / 7e-95 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.002G180000 [exp] 71 / 2e-15 AT4G01410 232 / 9e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.014G106100 [exp] 68 / 5e-14 AT4G01410 185 / 7e-59 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G071600 [exp] 66 / 3e-13 AT2G35980 205 / 9e-67 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.003G039400 [exp] 65 / 8e-13 AT1G17620 208 / 1e-66 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G204300 [exp] 65 / 8e-13 AT2G35980 208 / 6e-68 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.001G200700 [exp] 61 / 3e-11 AT1G17620 168 / 2e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.009G019600 [exp] 57 / 3e-10 AT3G44220 242 / 8e-82 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.001G218300 [exp] 54 / 5e-09 AT2G27260 94 / 6e-23 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [flax] [poplar] E-set PF03168 [flax] [poplar] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10018376 pacid=23162156 polypeptide=Lus10018376 locus=Lus10018376.g ID=Lus10018376.BGIv1.0 annot-version=v1.0 ATGTCGAAACAACCCATAAGACCCATGAAGCTACATTGCCTCATTGGCTTCACCATCCTCCTCTTCGTCGGCATCATCACCTTAATTTGCTGCCTAGGCT TGCGCCCGCACAAGCCCAAGTTCGAGCTCCACAACTTCGCCGTACTGGGTCTCGATCGGGCTAACGGGTTCCAGTCCACTAACATCTTCTTCAACGTATC GGTGAAGAATCCCAACAGGGGACTGAAGATCACCTACGAGACGCTCTCGGCTTCTGTGTACTACAAAGGGGAGCAAATCGGGTCGACTCCCTCGTTTGGT TCTTTCGAGGAGGGGCCCGAGAATACCACGTACATTTTTCATGTGTTGAACGGAGGGGTTATGGCGGGGAGCTACGGTGGTCAGCCTTGGATGGCGGTCA CGAACGATCGAGCTAAGGGAGCGGTTGAGTTTCGGTTGGAGTTGGAGTCGACGATTCGGTATCGGAAGACCATATTGGATCTAAGGAAGCATCGGTTGCA TCCTAAGTGTCATGTTTCAGTGGGTTATGATGGGGTTTTGTTGCCTAGTTATGCTAACAAAAAATGTTCACTATAA
AA sequence Show only first row Show all	>Lus10018376 pacid=23162156 polypeptide=Lus10018376 locus=Lus10018376.g ID=Lus10018376.BGIv1.0 annot-version=v1.0 MSKQPIRPMKLHCLIGFTILLFVGIITLICCLGLRPHKPKFELHNFAVLGLDRANGFQSTNIFFNVSVKNPNRGLKITYETLSASVYYKGEQIGSTPSFG SFEEGPENTTYIFHVLNGGVMAGSYGGQPWMAVTNDRAKGAVEFRLELESTIRYRKTILDLRKHRLHPKCHVSVGYDGVLLPSYANKKCSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G05220			Late embryogenesis abundant (L...		Lus10018376 [exp]	0	1
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10026419 [exp]	3.0	0.7947
					Lus10042766 [exp]	13.9	0.8262
AT1G73210			Protein of unknown function (D...		Lus10018267 [exp]	19.7	0.7571
AT5G65660			hydroxyproline-rich glycoprote...		Lus10028221 [exp]	26.0	0.8147
AT2G30210		LAC3	laccase 3 (.1)		Lus10026400 [exp]	33.4	0.7145
AT4G13260		YUC2	YUCCA2, Flavin-binding monooxy...		Lus10023637 [exp]	55.5	0.7659
AT4G31500		SUR2, RNT1, RED...	SUPERROOT 2, RUNT 1, RED ELONG...		Lus10033172 [exp]	96.9	0.7265
AT2G27550		ATC	centroradialis (.1)		Lus10019518 [exp]	97.4	0.6974
AT1G67370		ASY1, ATASY1	ASYNAPTIC 1, DNA-binding HORMA...		Lus10030933 [exp]	149.5	0.7242
AT5G19875			unknown protein		Lus10008006 [exp]	245.3	0.7105

Compare expression of checked genes

Lus10018376 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.