Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23180 181 / 4e-54 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) AT4G23140 176 / 4e-52 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT4G23160 176 / 3e-51 CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) AT4G23150 166 / 1e-48 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT4G05200 160 / 2e-46 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) AT4G11530 160 / 3e-46 CRK34 cysteine-rich RLK (RECEPTOR-like protein kinase) 34 (.1) AT3G45860 159 / 4e-46 CRK4 cysteine-rich RLK (RECEPTOR-like protein kinase) 4 (.1) AT4G11470 157 / 3e-45 CRK31 cysteine-rich RLK (RECEPTOR-like protein kinase) 31 (.1) AT4G38830 155 / 9e-45 CRK26 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1) AT4G23260 155 / 2e-44 CRK18 cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 18 (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018381 [exp] 157 / 3e-48 AT4G23180 283 / 3e-91 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10018382 [exp] 162 / 3e-47 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Lus10007632 [exp] 161 / 1e-46 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10018379 [exp] 159 / 6e-46 AT4G23180 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10007633 [exp] 153 / 1e-43 AT4G05200 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10007609 [exp] 137 / 8e-42 AT1G11410 142 / 5e-40 S-locus lectin protein kinase family protein (.1) Lus10007635 [exp] 146 / 5e-41 AT4G21410 385 / 6e-122 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Lus10009583 [exp] 134 / 1e-40 AT4G23310 164 / 2e-47 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) Lus10023391 [exp] 145 / 2e-40 AT1G11300 520 / 5e-168 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G024632 [exp] 208 / 5e-67 AT4G23180 527 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024404 [exp] 208 / 3e-64 AT4G23180 671 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024800 [exp] 207 / 5e-64 AT4G23180 663 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024500 [exp] 206 / 3e-63 AT4G23180 675 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.011G028400 [exp] 205 / 4e-63 AT4G05200 709 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G025100 [exp] 189 / 2e-62 AT4G23180 205 / 4e-63 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G025800 [exp] 202 / 6e-62 AT4G23180 648 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G025200 [exp] 196 / 2e-59 AT4G23180 665 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024900 [exp] 191 / 7e-58 AT4G23180 506 / 1e-171 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G025900 [exp] 189 / 7e-57 AT4G23130 573 / 0.0 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF07714 [flax] [poplar] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Lus10018378 pacid=23162211 polypeptide=Lus10018378 locus=Lus10018378.g ID=Lus10018378.BGIv1.0 annot-version=v1.0 ATGTCTCCAGAATACGCAATGTACGGACAGTTCTCAGCGAAATCCGACGTGTACAGTTTCGGAGTCCTACTCTTGGAGATCATAACCGGACTGAAAAACT CCACCTTCACTAAAAAGGACGGCGCACAAGATCTCTTGGGCTACGTTTGGAGGAACTGGAGAGACGGGACGCCGTTGGAAGTGCTGGATGCAACGTTGCT GGATTCTTACTCCAACAACGAAGTCATTAGATGCATTCACATTGGTTTGGTTTGCGTACAAGAAAATCCGGCTGATAGGCCGACAATGGCAACGGTGGTT CTGATGCTGAGTACTGGTTACTCCATCACTCAGCCGATGCCTAAGCAGCCGGCATTCTTCTCTCCGACGAGAGTGACCAGTTGGAGCTCTGGTGGCAGGG GTGGAGGAGGAACGATGCAGGCGGTGGAGAGTGACCAATCTTGTTGTAAATCAGCGGCATGGTCTGTTAATGACGCTTCCATCACTGACGTATATCCTCG TTGA
AA sequence Show only first row Show all	>Lus10018378 pacid=23162211 polypeptide=Lus10018378 locus=Lus10018378.g ID=Lus10018378.BGIv1.0 annot-version=v1.0 MSPEYAMYGQFSAKSDVYSFGVLLLEIITGLKNSTFTKKDGAQDLLGYVWRNWRDGTPLEVLDATLLDSYSNNEVIRCIHIGLVCVQENPADRPTMATVV LMLSTGYSITQPMPKQPAFFSPTRVTSWSSGGRGGGGTMQAVESDQSCCKSAAWSVNDASITDVYPR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10018378 [exp]	0	1
AT2G45630			D-isomer specific 2-hydroxyaci...		Lus10011141 [exp]	10.0	0.8763
					Lus10000100 [exp]	13.5	0.9048
					Lus10018556 [exp]	14.4	0.8909
AT5G06730			Peroxidase superfamily protein...		Lus10008174 [exp]	14.5	0.8905
AT3G06880			Transducin/WD40 repeat-like su...		Lus10017257 [exp]	33.2	0.8894
AT3G26170		CYP71B19	"cytochrome P450, family 71, s...		Lus10018261 [exp]	37.1	0.8908
AT4G16740		ATTPS03	terpene synthase 03 (.1.2)		Lus10012312 [exp]	42.6	0.8903
					Lus10023006 [exp]	42.8	0.8628
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10010652 [exp]	47.6	0.8884
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Lus10025749 [exp]	49.5	0.8819

Compare expression of checked genes

Lus10018378 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.