Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11530 125 / 5e-38 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1) AT2G40790 74 / 1e-17 ATCXXS2 C-terminal cysteine residue is changed to a serine 2 (.1) AT3G56420 74 / 2e-17 Thioredoxin superfamily protein (.1) AT1G45145 70 / 3e-16 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT3G51030 69 / 8e-16 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT3G08710 67 / 7e-15 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT1G19730 62 / 3e-13 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT5G39950 62 / 4e-13 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G59730 60 / 3e-12 ATH7 thioredoxin H-type 7 (.1) AT5G42980 57 / 2e-11 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007630 [exp] 218 / 1e-74 AT1G11530 143 / 4e-45 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10020070 [exp] 146 / 3e-46 AT1G11530 145 / 4e-46 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10022727 [exp] 76 / 4e-18 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014186 [exp] 75 / 5e-18 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10024293 [exp] 69 / 7e-16 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 68 / 2e-15 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10014277 [exp] 67 / 5e-15 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10028349 [exp] 65 / 2e-14 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10012859 [exp] 64 / 1e-13 AT3G08710 134 / 9e-41 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G031700 [exp] 148 / 5e-47 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.001G416500 [exp] 131 / 2e-40 AT1G11530 162 / 1e-52 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.006G110100 [exp] 77 / 1e-18 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.016G138800 [exp] 76 / 1e-18 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.005G232700 [exp] 69 / 5e-16 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.011G031100 [exp] 69 / 8e-16 AT1G11530 94 / 9e-26 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.002G030000 [exp] 67 / 4e-15 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.019G062000 [exp] 66 / 2e-14 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.007G018000 [exp] 63 / 2e-13 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.015G036000 [exp] 64 / 1e-12 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10018383 pacid=23162153 polypeptide=Lus10018383 locus=Lus10018383.g ID=Lus10018383.BGIv1.0 annot-version=v1.0 ATGAACAACCATGGGGAGCAAATCAAGTCAAAGGTTCTAAAGGTTGACTCTTTACAGACATGGGAAGTTTCCATTAGCCAAGCTTCCTCCTCCCCTGTGA TTGCGCATTTCACAGCTTCATGGTGTATGCCATCTGTGGCGATGAGCCCTGTGTTTGAAGAGCTCTCTTTAGCTTACCCAGATTCCGTCTTCCTCTCTGT GGATGTTGATGATGTTAAGGAAGTGGCTGCTAAGCTAGAGGTGAAAGCCATGCCTACTTTTGTGCTGATGAAAGATGGAGCTCAGGGTGACAAACTCGTC GGAGCTAATCCTGATGAGATCAGGAAAAGGGTCCACAGCTTTATTCAAACGTCTTCTTCTTCCTCATCGTCTCTCTCGACAATCACTGAAGTTGAAGCTC AAGCTTAG
AA sequence Show only first row Show all	>Lus10018383 pacid=23162153 polypeptide=Lus10018383 locus=Lus10018383.g ID=Lus10018383.BGIv1.0 annot-version=v1.0 MNNHGEQIKSKVLKVDSLQTWEVSISQASSSPVIAHFTASWCMPSVAMSPVFEELSLAYPDSVFLSVDVDDVKEVAAKLEVKAMPTFVLMKDGAQGDKLV GANPDEIRKRVHSFIQTSSSSSSSLSTITEVEAQA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Lus10018383 [exp]	0	1
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Lus10007630 [exp]	1.0	0.9808
AT5G53160		RCAR3, PYL8	PYR1-like 8, regulatory compon...		Lus10039335 [exp]	3.5	0.9691
AT1G35190			2-oxoglutarate (2OG) and Fe(II...		Lus10043026 [exp]	4.5	0.9737
AT3G15290			3-hydroxyacyl-CoA dehydrogenas...		Lus10020828 [exp]	7.0	0.9652
AT3G54380		AtSAC3C	yeast Sac3 homolog C, SAC3/GAN...		Lus10041609 [exp]	7.1	0.9451
AT1G70460		AtPERK13, RHS10	proline-rich extensin-like rec...		Lus10030879 [exp]	7.2	0.9683
AT5G03455		ACR2, ARATH;CDC...	ARSENATE REDUCTASE 2, Rhodanes...		Lus10022616 [exp]	7.5	0.9562
AT4G28240			Wound-responsive family protei...		Lus10039758 [exp]	8.1	0.9586
AT3G60340			alpha/beta-Hydrolases superfam...		Lus10004375 [exp]	8.7	0.9656
AT5G58800			Quinone reductase family prote...		Lus10005862 [exp]	8.8	0.9506

Compare expression of checked genes

Lus10018383 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.