Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G49725 107 / 6e-28 GTP-binding protein, HflX (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G007700 [exp] 130 / 3e-36 AT3G49725 513 / 3e-176 GTP-binding protein, HflX (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018404 pacid=23162210 polypeptide=Lus10018404 locus=Lus10018404.g ID=Lus10018404.BGIv1.0 annot-version=v1.0 ATGTTGGCTCTCTCACTAAAATCGCGTCTGCAATCCCTAACGCAGACCTCCTTCCGATCGCTCGCAGCTCCAGTAATCTCCCATCTCTCGTCATCTTTCT CCACCAAGCAGCGGGACGGCGGCGGCGGCGATTCATCCGACGCCAGCTTGATCTTAAACAGGGATCCGGACAGTCCTCCCCGCCTCTTCGTCGTCCAGCC GCGCCTCCGCCCTGACTCCTTCCTCCAAGCGAAGCTCAATGAAGCTCTTTGCCTCGCTAATTCCCTTGAAGAGCAGCGCGATGGTTGCTTTCTCATTGAT TTCTTCGATAAGAAGCTGCCTCCTCATGTTCTCGTTCAGAATCCCATCCTAAGATCCTCCAGTGCTCACGCAGGTTCTGGACCTTAA
AA sequence Show only first row Show all	>Lus10018404 pacid=23162210 polypeptide=Lus10018404 locus=Lus10018404.g ID=Lus10018404.BGIv1.0 annot-version=v1.0 MLALSLKSRLQSLTQTSFRSLAAPVISHLSSSFSTKQRDGGGGDSSDASLILNRDPDSPPRLFVVQPRLRPDSFLQAKLNEALCLANSLEEQRDGCFLID FFDKKLPPHVLVQNPILRSSSAHAGSGP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G49725			GTP-binding protein, HflX (.1)		Lus10018404 [exp]	0	1
AT4G32050			neurochondrin family protein (...		Lus10032403 [exp]	2.8	0.8182
AT2G44980		ASG3	ALTERED SEED GERMINATION 3, SN...		Lus10028186 [exp]	11.4	0.8098
AT2G39090		APC7, AtAPC7	anaphase-promoting complex 7, ...		Lus10034164 [exp]	14.1	0.8085
AT5G22050			Protein kinase superfamily pro...		Lus10013365 [exp]	14.2	0.7782
AT1G73020			unknown protein		Lus10009732 [exp]	16.4	0.8127
AT1G20410			Pseudouridine synthase family ...		Lus10021236 [exp]	23.0	0.7625
AT3G52640			Zn-dependent exopeptidases sup...		Lus10007388 [exp]	24.4	0.7961
AT1G63110			GPI transamidase subunit PIG-U...		Lus10006320 [exp]	27.8	0.7518
AT4G32730	MYB	ATMYB3R-1, PC-M...	C-MYB-LIKE TRANSCRIPTION FACTO...		Lus10038623 [exp]	29.7	0.7709
AT3G57570			ARM repeat superfamily protein...		Lus10042364 [exp]	30.5	0.7889

Compare expression of checked genes

Lus10018404 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.