Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G21445 154 / 5e-49 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002594 [exp] 191 / 6e-64 AT4G21445 155 / 2e-49 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G041800 [exp] 152 / 2e-48 AT4G21445 155 / 3e-49 unknown protein Potri.004G033400 [exp] 151 / 4e-48 AT4G21445 154 / 6e-49 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018419 pacid=23162219 polypeptide=Lus10018419 locus=Lus10018419.g ID=Lus10018419.BGIv1.0 annot-version=v1.0 ATGAACTCCTCTCTCAAACCCATCCAACCTCATCTCCTCCACCACCACCACCACAAAACTCCTCCATCATTCTTCCTGGGCCGACAAAAACCCACCGCTC CTCTCCGAATTCGATGCAGCAGTGGCGAAAAGCGGAGCTTCCTGAGCCTCGAAGAAGCGGGCCTGGTCGAAGTCTCCGGCCTCAGCACCCACGAGAAGTT CCTCTGCCGCCTGACGATATCGTCGTTGAATCTGCTGAAGGTGATGTCTGAGCAGGAAGGGTGCGCCATTGAAGAGCTGAATGCTGGGAAAGTATGCGAC TGGTTCTTGAAAGATAAGCTTAAGAGAGAACAGAGTCTCGACTCTGCTGTTCTTCAGTGGGATGATTCTGATTTCCCCATTTGA
AA sequence Show only first row Show all	>Lus10018419 pacid=23162219 polypeptide=Lus10018419 locus=Lus10018419.g ID=Lus10018419.BGIv1.0 annot-version=v1.0 MNSSLKPIQPHLLHHHHHKTPPSFFLGRQKPTAPLRIRCSSGEKRSFLSLEEAGLVEVSGLSTHEKFLCRLTISSLNLLKVMSEQEGCAIEELNAGKVCD WFLKDKLKREQSLDSAVLQWDDSDFPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G21445			unknown protein		Lus10018419 [exp]	0	1
AT3G18890		AtTic62	translocon at the inner envelo...		Lus10026321 [exp]	2.4	0.9261
AT5G02890			HXXXD-type acyl-transferase fa...		Lus10004360 [exp]	2.8	0.8946
AT2G23580		ATMES4, ABE4	ARABIDOPSIS THALIANA METHYL ES...		Lus10009205 [exp]	8.1	0.8898
AT1G09340		CSP41B, CRB, HI...	heteroglycan-interacting prote...		Lus10031435 [exp]	9.6	0.9133
AT3G08010		ATAB2	RNA binding (.1)		Lus10029507 [exp]	11.9	0.9081
AT1G62750		ATSCO1, ATSCO1/...	SNOWY COTYLEDON 1, Translation...		Lus10028909 [exp]	17.1	0.8896
AT1G09340		CSP41B, CRB, HI...	heteroglycan-interacting prote...		Lus10001525 [exp]	17.7	0.9070
AT1G32080		AtLrgB	membrane protein, putative (.1...		Lus10010412 [exp]	18.6	0.9020
AT3G52380		CP33, PDE322	PIGMENT DEFECTIVE 322, chlorop...		Lus10013591 [exp]	20.0	0.8917
AT5G19220		ADG2, APL1	ADP GLUCOSE PYROPHOSPHORYLASE ...		Lus10010515 [exp]	21.0	0.8945

Compare expression of checked genes

Lus10018419 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.