Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002596 [exp] 84 / 2e-23 ND 32 / 0.007
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G042000 [exp] 37 / 8e-05 AT4G28240 41 / 3e-06 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10018421 pacid=23162171 polypeptide=Lus10018421 locus=Lus10018421.g ID=Lus10018421.BGIv1.0 annot-version=v1.0 ATGAGCTGCTCTGCAAAACTCCAGACGGATATCGGCGTCGTCTCCGGTGGCGACGGAGGAGGAAACCCAGATGGGCGACGGATTTTCAAGCGGAGCTACC GTTCCGGTGATAAAGGCTGTGCCTTTCTAGCTGGAGGTGTTGAGGAAGAAGGAAGTAGGAAGGGGAAACAGATTGAAGAGTCGTTGCAGAGAGTTATGTA TTTCAACTGCTGGGCTCTTAGCTAA
AA sequence Show only first row Show all	>Lus10018421 pacid=23162171 polypeptide=Lus10018421 locus=Lus10018421.g ID=Lus10018421.BGIv1.0 annot-version=v1.0 MSCSAKLQTDIGVVSGGDGGGNPDGRRIFKRSYRSGDKGCAFLAGGVEEEGSRKGKQIEESLQRVMYFNCWALS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018421 [exp]	0	1
AT1G72360	AP2_ERF	AtERF73, HRE1	HYPOXIA RESPONSIVE ERF \(ETHYL...		Lus10008214 [exp]	1.4	0.9906
					Lus10002596 [exp]	1.4	0.9905
AT1G76600			unknown protein		Lus10033761 [exp]	3.2	0.9839
AT3G10920		MSD1, MEE33, AT...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10030534 [exp]	3.5	0.9876
AT3G50390			Transducin/WD40 repeat-like su...		Lus10016779 [exp]	4.0	0.9868
AT5G39890			Protein of unknown function (D...		Lus10003861 [exp]	5.3	0.9821
AT2G36530		ENO2, LOS2	LOW EXPRESSION OF OSMOTICALLY ...		Lus10038904 [exp]	5.5	0.9839
AT4G26270		PFK3	phosphofructokinase 3 (.1)		Lus10043044 [exp]	5.7	0.9780
AT3G48660			Protein of unknown function (D...		Lus10003120 [exp]	7.3	0.9796
AT3G14880			unknown protein		Lus10042453 [exp]	8.2	0.9718

Compare expression of checked genes

Lus10018421 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.