Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G33730 110 / 3e-30 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G28180 103 / 1e-27 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT4G33370 60 / 3e-12 DEA(D/H)-box RNA helicase family protein (.1) AT5G51280 56 / 5e-11 DEAD-box protein abstrakt, putative (.1) AT3G06480 55 / 1e-10 DEAD box RNA helicase family protein (.1) AT3G01540 53 / 8e-10 ATDRH1, DRH1 ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE 1, DEAD box RNA helicase 1 (.1.2.3.4) AT5G14610 52 / 9e-10 DEAD box RNA helicase family protein (.1.2) AT1G20920 51 / 4e-09 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT1G55150 51 / 4e-09 DEA(D/H)-box RNA helicase family protein (.1) AT3G58510 50 / 5e-09 DEA(D/H)-box RNA helicase family protein (.1), DEA(D/H)-box RNA helicase family protein (.2), DEA(D/H)-box RNA helicase family protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015187 [exp] 126 / 1e-35 AT2G33730 1083 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10012899 [exp] 57 / 1e-11 AT5G51280 318 / 1e-106 DEAD-box protein abstrakt, putative (.1) Lus10008856 [exp] 57 / 3e-11 AT5G51280 851 / 0.0 DEAD-box protein abstrakt, putative (.1) Lus10009474 [exp] 56 / 6e-11 AT3G06480 744 / 0.0 DEAD box RNA helicase family protein (.1) Lus10001272 [exp] 56 / 6e-11 AT5G14610 665 / 0.0 DEAD box RNA helicase family protein (.1.2) Lus10023252 [exp] 56 / 7e-11 AT5G51280 1015 / 0.0 DEAD-box protein abstrakt, putative (.1) Lus10035149 [exp] 50 / 1e-09 AT5G14610 218 / 1e-68 DEAD box RNA helicase family protein (.1.2) Lus10020088 [exp] 52 / 2e-09 AT3G02065 677 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Lus10014553 [exp] 52 / 3e-09 AT5G14610 833 / 0.0 DEAD box RNA helicase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G037200 [exp] 117 / 2e-32 AT2G33730 1058 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.012G045800 [exp] 116 / 3e-32 AT2G33730 994 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.004G224000 [exp] 56 / 5e-11 AT5G51280 1072 / 0.0 DEAD-box protein abstrakt, putative (.1) Potri.005G047301 [exp] 56 / 7e-11 AT5G51280 520 / 0.0 DEAD-box protein abstrakt, putative (.1) Potri.017G071400 [exp] 55 / 2e-10 AT5G14610 792 / 0.0 DEAD box RNA helicase family protein (.1.2) Potri.001G347100 [exp] 54 / 3e-10 AT5G14610 823 / 0.0 DEAD box RNA helicase family protein (.1.2) Potri.010G152400 [exp] 52 / 2e-09 AT3G06480 801 / 0.0 DEAD box RNA helicase family protein (.1) Potri.015G083000 [exp] 50 / 5e-09 AT5G63120 707 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.001G007900 [exp] 50 / 1e-08 AT2G42520 807 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.006G196000 [exp] 48 / 4e-08 AT3G58570 790 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018428 pacid=23162192 polypeptide=Lus10018428 locus=Lus10018428.g ID=Lus10018428.BGIv1.0 annot-version=v1.0 ATGCCCGGGAGTATCGAGATGTACGCTCATCGTATTGGACAGACAGGACGTGCTGGGGAGACTGGCGTGGCCATAAAGTTTATAACCTTGCAAGACTCTG ATGTTTTCTACGACCTGAAGCAGATGCTTATCTCGAGTAATAGTCCGGTGCCCCCTGATCTTGCGAGGCACGAAGCTTCGAAGTTCAAGCCCGGACAGAC CTCCTAG
AA sequence Show only first row Show all	>Lus10018428 pacid=23162192 polypeptide=Lus10018428 locus=Lus10018428.g ID=Lus10018428.BGIv1.0 annot-version=v1.0 MPGSIEMYAHRIGQTGRAGETGVAIKFITLQDSDVFYDLKQMLISSNSPVPPDLARHEASKFKPGQTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G33730			P-loop containing nucleoside t...		Lus10018428 [exp]	0	1
AT1G66230	MYB	ATMYB20	myb domain protein 20 (.1)		Lus10004042 [exp]	3.7	1.0000
					Lus10011962 [exp]	5.3	1.0000
AT2G20340			Pyridoxal phosphate (PLP)-depe...		Lus10012601 [exp]	6.5	1.0000
					Lus10022805 [exp]	7.5	1.0000
AT5G05530			RING/U-box superfamily protein...		Lus10024629 [exp]	8.4	1.0000
AT2G15220			Plant basic secretory protein ...		Lus10026579 [exp]	9.2	1.0000
AT2G36620		RPL24A	ribosomal protein L24 (.1)		Lus10014637 [exp]	9.5	1.0000
AT5G04350			Plant self-incompatibility pro...		Lus10029388 [exp]	10.6	1.0000
					Lus10030558 [exp]	11.2	1.0000
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Lus10030911 [exp]	11.4	1.0000

Compare expression of checked genes

Lus10018428 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.