Lus10018443 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10018443 pacid=23162119 polypeptide=Lus10018443 locus=Lus10018443.g ID=Lus10018443.BGIv1.0 annot-version=v1.0
ATGTACGGGACACAAGACAATGATCGATTGGGAACGATACATCAGCTGAAATCCGGAATGATTTTCAGCTTAAGCATTTCGACGCAGGGCCTTCTCATTG
ATGAAGATGATCGGTGCAGGTCTGAGTATTACATAAATCAATATAACAGAAATGCAGAAAGCAGAGTCCTATATGGAAATCCCAACGGCTACTGGCGGCT
TCTGCTTGAGCACGGACTTCACGTGCTAAGATCTTCGCCATTCGCTTCGGTTTCGCAGAAAAGAGAGTCCTATATGGAAATTCCAACGGCTACTGGCGGC
TTCTGCTTGAACATGGACTTCTCAAGTGCTAAGATCTTCGCCATTCGCTTCGGTTTCGAGTCAGGAAACGTACGGGCATCCAACTGGGACGACGACAGAT
GA
AA sequence
>Lus10018443 pacid=23162119 polypeptide=Lus10018443 locus=Lus10018443.g ID=Lus10018443.BGIv1.0 annot-version=v1.0
MYGTQDNDRLGTIHQLKSGMIFSLSISTQGLLIDEDDRCRSEYYINQYNRNAESRVLYGNPNGYWRLLLEHGLHVLRSSPFASVSQKRESYMEIPTATGG
FCLNMDFSSAKIFAIRFGFESGNVRASNWDDDR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10018443 0 1
AT5G15430 Plant calmodulin-binding prote... Lus10000209 4.6 0.9410
Lus10032472 6.0 0.9356
AT5G27870 Plant invertase/pectin methyle... Lus10037489 6.5 0.9343
AT3G61230 LIM PLIM2c PLIM2c, GATA type zinc finger ... Lus10029859 7.7 0.9336
AT1G29670 GDSL-like Lipase/Acylhydrolase... Lus10011998 10.7 0.9303
AT1G15910 FDM1 factor of DNA methylation 1, X... Lus10040287 11.2 0.9286
AT1G29670 GDSL-like Lipase/Acylhydrolase... Lus10002775 12.0 0.9266
AT3G56570 SET domain-containing protein ... Lus10029539 12.7 0.9268
AT4G26110 NAP1;1, ATNAP1;... ARABIDOPSIS THALIANA NUCLEOSOM... Lus10026197 12.7 0.9234
AT2G45010 PLAC8 family protein (.1.2) Lus10042885 16.6 0.9188

Lus10018443 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.