Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G35090 36 / 0.0009 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011220 [exp] 113 / 1e-34 ND 39 / 1e-04 Lus10001933 [exp] 37 / 0.0004 AT5G14890 78 / 4e-17 NHL domain-containing protein (.1) Lus10001942 [exp] 37 / 0.0004 AT5G14890 79 / 1e-17 NHL domain-containing protein (.1) Lus10001932 [exp] 37 / 0.0004 AT5G14890 76 / 1e-17 NHL domain-containing protein (.1) Lus10033413 [exp] 37 / 0.0007 AT5G14890 96 / 3e-23 NHL domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G037500 [exp] 63 / 1e-14 ND / Potri.011G046112 [exp] 51 / 3e-09 ND / Potri.007G000801 [exp] 45 / 9e-08 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018463 pacid=23162228 polypeptide=Lus10018463 locus=Lus10018463.g ID=Lus10018463.BGIv1.0 annot-version=v1.0 ATGGGTCTGATCCAGAAGCAATGCAGAACCTTGTTCTGGAGGATGAGAGCTTCAGTGAAAAAATCAGTCAAGAAATGGAGTTCCAGTCAGCATCCTAGAA AGAGATTCCAGTATGATCCTTCCAGCTACGCCCTCAACTTCGACGACGGTGGCTACTGTCGGTTCTCCTCCGCCGGCGGCGGCTCGTGTCCGTTGAAGAT TGGGATCAATGTCGAAGAGTCTGCGATCTGGGTTTATGTTTTCTGGGTTTGA
AA sequence Show only first row Show all	>Lus10018463 pacid=23162228 polypeptide=Lus10018463 locus=Lus10018463.g ID=Lus10018463.BGIv1.0 annot-version=v1.0 MGLIQKQCRTLFWRMRASVKKSVKKWSSSQHPRKRFQYDPSSYALNFDDGGYCRFSSAGGGSCPLKIGINVEESAIWVYVFWV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018463 [exp]	0	1
AT3G05600			alpha/beta-Hydrolases superfam...		Lus10020663 [exp]	2.4	0.9444
AT1G76420	NAC	NAC368, CUC3, A...	CUP SHAPED COTYLEDON3, Arabido...		Lus10030723 [exp]	3.2	0.9490
AT5G45650			subtilase family protein (.1)		Lus10007083 [exp]	4.5	0.9302
AT5G01840	OFP	AtOFP1	ARABIDOPSIS THALIANA OVATE FAM...		Lus10042224 [exp]	5.0	0.8799
					Lus10011220 [exp]	5.2	0.9423
AT1G44760			Adenine nucleotide alpha hydro...		Lus10029664 [exp]	5.3	0.8768
AT5G02130		NDP1	Tetratricopeptide repeat (TPR)...		Lus10024371 [exp]	8.0	0.9106
AT1G23000			Heavy metal transport/detoxifi...		Lus10032445 [exp]	8.4	0.9233
AT4G35170			Late embryogenesis abundant (L...		Lus10022644 [exp]	8.4	0.8963
AT1G17140		RIP1, ICR1	ROP INTERACTIVE PARTNER 1, int...		Lus10013708 [exp]	8.8	0.9144

Compare expression of checked genes

Lus10018463 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.