Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G04950 196 / 2e-61 AtGRXS17 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) AT4G32580 179 / 5e-59 Thioredoxin superfamily protein (.1) AT3G56420 69 / 1e-15 Thioredoxin superfamily protein (.1) AT2G40790 62 / 4e-13 ATCXXS2 C-terminal cysteine residue is changed to a serine 2 (.1) AT3G17880 64 / 7e-13 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT1G11530 60 / 1e-12 ATCXXS1 C-terminal cysteine residue is changed to a serine 1 (.1) AT1G43560 58 / 2e-11 ATY2 thioredoxin Y2 (.1) AT3G51030 56 / 9e-11 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT5G39950 55 / 2e-10 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G45145 55 / 2e-10 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011188 [exp] 257 / 7e-89 AT4G04950 297 / 1e-99 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Lus10007630 [exp] 62 / 7e-13 AT1G11530 143 / 4e-45 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10018383 [exp] 60 / 3e-12 AT1G11530 145 / 3e-46 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10029009 [exp] 59 / 1e-11 AT3G08710 126 / 5e-38 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10000802 [exp] 56 / 8e-11 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10024293 [exp] 56 / 1e-10 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10030505 [exp] 56 / 3e-10 AT3G08710 132 / 8e-40 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10020070 [exp] 54 / 5e-10 AT1G11530 145 / 4e-46 C-terminal cysteine residue is changed to a serine 1 (.1) Lus10041799 [exp] 54 / 6e-10 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G042200 [exp] 205 / 3e-65 AT4G04950 750 / 0.0 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Potri.011G051400 [exp] 195 / 6e-61 AT4G04950 680 / 0.0 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Potri.005G232700 [exp] 67 / 4e-15 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.016G138800 [exp] 63 / 2e-13 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.004G031700 [exp] 61 / 1e-12 AT1G11530 179 / 1e-59 C-terminal cysteine residue is changed to a serine 1 (.1) Potri.008G194100 [exp] 60 / 3e-12 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.019G062000 [exp] 60 / 3e-12 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.015G036000 [exp] 60 / 1e-11 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.002G030000 [exp] 57 / 2e-11 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G066800 [exp] 57 / 7e-11 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10018486 pacid=23162179 polypeptide=Lus10018486 locus=Lus10018486.g ID=Lus10018486.BGIv1.0 annot-version=v1.0 ATGGGTGGAGCTGTGAAAGATTTGAAGTCGAAGGCGGAGCTCGACGGACTGCTGAAGAGCGGCGGAGCTCCGGTGATCCTGCACTTCTGGGCGGACTGGT GCGAGACGTCTAAGCAAATGGACCAAGTCTTCTCCCACCTCTCCACCGATTTCCCAGTCGTCGATTTCCTCAGAGTTGAGGCCGAGGAGCAGCCTGAGAT ATCCGAGGCTTACTCCGTTTCCGCGGTGCCGTTTGTCGTCTTCTTGAAGGATGGAAAGATTGTTGACAAGTTGGAAGGTTGGGAACCGTCCAGTTTGGCA AACAAAGTCGCGAAAATTGCCGGATCAGTCGACCCTGCATATCCTGCTGCTCCTGCAAGTCTCGGAATGGCTGCTGGGCCGACTCTTCTCTAG
AA sequence Show only first row Show all	>Lus10018486 pacid=23162179 polypeptide=Lus10018486 locus=Lus10018486.g ID=Lus10018486.BGIv1.0 annot-version=v1.0 MGGAVKDLKSKAELDGLLKSGGAPVILHFWADWCETSKQMDQVFSHLSTDFPVVDFLRVEAEEQPEISEAYSVSAVPFVVFLKDGKIVDKLEGWEPSSLA NKVAKIAGSVDPAYPAAPASLGMAAGPTLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G04950		AtGRXS17	Arabidopsis thaliana monothiol...		Lus10018486 [exp]	0	1
AT3G26560			ATP-dependent RNA helicase, pu...		Lus10037145 [exp]	5.3	0.8672
AT3G15010			RNA-binding (RRM/RBD/RNP motif...		Lus10015290 [exp]	6.6	0.8767
AT5G45330		DCP5-L	decapping 5-like (.1)		Lus10035052 [exp]	10.2	0.8617
AT3G22980			Ribosomal protein S5/Elongatio...		Lus10004749 [exp]	12.0	0.8346
AT1G04860		ATUBP2, UBP2	ubiquitin-specific protease 2 ...		Lus10016664 [exp]	13.6	0.8571
AT1G50380			Prolyl oligopeptidase family p...		Lus10015387 [exp]	14.3	0.8478
AT5G19130			GPI transamidase component fam...		Lus10032125 [exp]	16.9	0.8375
AT5G16420			Pentatricopeptide repeat (PPR-...		Lus10030222 [exp]	17.0	0.8343
AT3G54540		ABCF4, ATGCN4	ATP-binding cassette F4, gener...		Lus10029363 [exp]	21.1	0.8454
AT5G53150			DNAJ heat shock N-terminal dom...		Lus10038816 [exp]	27.0	0.8149

Compare expression of checked genes

Lus10018486 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.