Lus10018503 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G03210 439 / 9e-157 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
AT5G13870 323 / 5e-111 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
AT2G06850 310 / 6e-106 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1)
AT5G65730 303 / 6e-103 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT4G37800 301 / 2e-102 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1)
AT3G23730 301 / 3e-102 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 294 / 1e-99 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 290 / 5e-98 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G25810 288 / 2e-97 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 282 / 4e-95 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039715 606 / 0 AT4G03210 441 / 1e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10031586 539 / 0 AT4G03210 446 / 9e-160 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10033755 393 / 1e-137 AT4G03210 340 / 5e-117 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10011052 327 / 5e-112 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10003022 324 / 3e-111 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10040121 321 / 5e-110 AT5G13870 493 / 5e-178 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10030923 317 / 2e-108 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10039643 296 / 3e-100 AT5G65730 469 / 1e-168 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10011597 296 / 3e-100 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G125000 496 / 2e-179 AT4G03210 450 / 3e-161 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Potri.013G152400 493 / 4e-178 AT4G03210 442 / 2e-158 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Potri.007G008500 322 / 9e-111 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Potri.003G159700 321 / 4e-110 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.001G071000 319 / 2e-109 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.014G140300 316 / 3e-108 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.013G005700 298 / 1e-100 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.011G077320 292 / 8e-99 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.006G170100 291 / 2e-98 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G169900 291 / 2e-98 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10018503 pacid=23180368 polypeptide=Lus10018503 locus=Lus10018503.g ID=Lus10018503.BGIv1.0 annot-version=v1.0
ATGGCGGTCTCAATCTCCAGAGCTTCTCTTCTGATAGCACTTTTCATGGGATTCGCTGCTCTAGCTATAGTCAGCTCAGCTCCCGCCAAGTTTGATGACC
TCTTCCAGCCGAGCTGGGCTTTTGATCACTTCGTCTATGAAGGAGAGCAGCTTAAGCTCAAACTTGATAACTATTCCGGTTCTGGGTTTCAATCGAAGAG
CAAGTACCTATTCGGAAAGGTGACGGTTCAGATTAAGCTTGTGGAAGGCGACTCCGCCGGAACTGTTACAGCCTTCTACATGTCGTCGGAGGGACTGACT
CACAACGAGTTCGATTTCGAGTTCCTGGGTAACAAAACAGGGGAGCCGTACGTTGTCCAGACGAATGTGTTCGTCAATGGCGTCGGCAACAGAGAGCAAA
GGTTGAACCTTTGGTTCGATCCCACCAAGGATTTCCACCGCTACTCCATCTTCTGGAACCCCAGCCAAGTCATATTTCTGGTGGACGACACTCCGATAAG
GCAGCACACGAACTTGGAGCACAAGGGGATCCCATTCCCGAAAGACCAACCAATGGGGGTCTACAGCTCGATCTGGAACGCGGACGACTGGGCGACCCAG
GGCGGTTTGGTCAAGACCGACTGGAGCCACGCGCCGTTTGTCGCTTCGTACAAAGGGTTTGAAATCGATGCTTGTGAAAGTCCGGCGACGGCGATGTCGG
CGGCTGATCTGACCAAGAAGTGCACCAGCAGTGGCGAGAAGAAGTTTTGGTGGGATGAGCCGACGTTGAGTGGGATGAATGTTCATCAGAGTCATCAGTT
GCTTTGGGTTAAGGCCAATCATATGATTTATGATTACTGTAGTGATAACTCGAGGTTCCCTGTTACGCCTGAGGAGTGTCGGCATCACCGCCATTGA
AA sequence
>Lus10018503 pacid=23180368 polypeptide=Lus10018503 locus=Lus10018503.g ID=Lus10018503.BGIv1.0 annot-version=v1.0
MAVSISRASLLIALFMGFAALAIVSSAPAKFDDLFQPSWAFDHFVYEGEQLKLKLDNYSGSGFQSKSKYLFGKVTVQIKLVEGDSAGTVTAFYMSSEGLT
HNEFDFEFLGNKTGEPYVVQTNVFVNGVGNREQRLNLWFDPTKDFHRYSIFWNPSQVIFLVDDTPIRQHTNLEHKGIPFPKDQPMGVYSSIWNADDWATQ
GGLVKTDWSHAPFVASYKGFEIDACESPATAMSAADLTKKCTSSGEKKFWWDEPTLSGMNVHQSHQLLWVKANHMIYDYCSDNSRFPVTPEECRHHRH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G03210 XTH9, EXGT-A6, ... xyloglucan endotransglucosylas... Lus10018503 0 1
AT4G03210 XTH9, EXGT-A6, ... xyloglucan endotransglucosylas... Lus10039715 1.0 0.8946
AT4G04720 CPK21 calcium-dependent protein kina... Lus10020046 4.9 0.8571
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10017605 8.1 0.8458
AT5G08370 ATAGAL2 alpha-galactosidase 2 (.1.2) Lus10038305 9.0 0.8595
AT3G23760 unknown protein Lus10043212 10.3 0.8675
AT2G21860 violaxanthin de-epoxidase-rela... Lus10002789 13.0 0.8440
AT5G14370 CCT motif family protein (.1) Lus10014886 13.3 0.8376
AT1G32060 PRK phosphoribulokinase (.1) Lus10030949 14.3 0.8471
AT2G15290 ATTIC21, TIC21,... PERMEASE IN CHLOROPLASTS 1, CH... Lus10019814 15.9 0.8430
AT5G14370 CCT motif family protein (.1) Lus10022311 17.9 0.8223

Lus10018503 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.