Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11360 60 / 4e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT4G27320 57 / 8e-11 ATPHOS34 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G54430 55 / 5e-10 ATPHOS32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039730 [exp] 80 / 3e-19 AT1G11360 288 / 3e-98 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10037867 [exp] 58 / 6e-11 AT1G11360 244 / 1e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10038561 [exp] 55 / 4e-10 AT1G11360 224 / 7e-74 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10033749 [exp] 48 / 1e-07 AT1G11360 245 / 1e-81 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10031594 [exp] 47 / 2e-07 AT1G11360 257 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G125500 [exp] 62 / 1e-12 AT5G54430 237 / 3e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.011G039800 [exp] 56 / 2e-10 AT1G11360 269 / 3e-91 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.001G409100 [exp] 54 / 7e-10 AT5G54430 226 / 2e-74 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G150200 [exp] 42 / 2e-05 AT1G11360 209 / 1e-67 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.019G119400 [exp] 42 / 2e-05 AT1G11360 164 / 2e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10018515 pacid=23180360 polypeptide=Lus10018515 locus=Lus10018515.g ID=Lus10018515.BGIv1.0 annot-version=v1.0 ATGAAGGAGAGGCTGTGTTTGGAAGTTGAGAGGCTAGGGTTGAGCGCTGTGATTATGGGGAGCAGAGGATTTGGAGCTGCGAGGAGGAGCGGTAAAGGGA GGTTAGGGAGTGTTAGTGATTACTGTGTTCATCACTGTATTTGTCCTGTGGTTGTTGTAAGGTATCCGGATGATAAGGATGGAGAAAGTGAAGATTTGAA GATAGGAGCTTCTGCTTCTGCTGCTGTTGTTGGAGAGGAGTCTGAGCTTCCTCCAGTGCCAGAGGTGGAACAGGAAGAGAAAGGTTCGAATCAATGCATT TGCTCAACTGTTTGA
AA sequence Show only first row Show all	>Lus10018515 pacid=23180360 polypeptide=Lus10018515 locus=Lus10018515.g ID=Lus10018515.BGIv1.0 annot-version=v1.0 MKERLCLEVERLGLSAVIMGSRGFGAARRSGKGRLGSVSDYCVHHCICPVVVVRYPDDKDGESEDLKIGASASAAVVGEESELPPVPEVEQEEKGSNQCI CSTV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11360			Adenine nucleotide alpha hydro...		Lus10018515 [exp]	0	1
AT4G39660		AGT2	alanine:glyoxylate aminotransf...		Lus10029922 [exp]	1.4	0.8531
AT3G25070		RIN4	RPM1 interacting protein 4 (.1...		Lus10022776 [exp]	2.0	0.8530
AT1G80180			unknown protein		Lus10014488 [exp]	4.2	0.8411
AT1G04130		TPR2, AtTPR2	tetratricopeptide repeat 2, Te...		Lus10025945 [exp]	4.5	0.8051
AT5G66590			CAP (Cysteine-rich secretory p...		Lus10022481 [exp]	4.9	0.8247
AT5G18900			2-oxoglutarate (2OG) and Fe(II...		Lus10016271 [exp]	10.1	0.8214
AT3G59920		ATGDI2	RAB GDP dissociation inhibitor...		Lus10027094 [exp]	11.2	0.8175
AT3G23490		CYN	cyanase (.1)		Lus10018091 [exp]	12.0	0.8009
AT5G14360			Ubiquitin-like superfamily pro...		Lus10022315 [exp]	12.0	0.7932
AT3G54840		ARA6, AtRABF1, ...	Ras-related small GTP-binding ...		Lus10028820 [exp]	12.4	0.8129

Compare expression of checked genes

Lus10018515 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.