Lus10018517 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16940 221 / 9e-76 carbon-sulfur lyases (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000116 291 / 3e-103 AT5G16940 221 / 1e-75 carbon-sulfur lyases (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G131900 236 / 1e-81 AT5G16940 222 / 4e-76 carbon-sulfur lyases (.1.2)
Potri.017G132500 218 / 2e-74 AT5G16940 208 / 1e-70 carbon-sulfur lyases (.1.2)
Potri.017G132000 204 / 3e-69 AT5G16940 198 / 1e-66 carbon-sulfur lyases (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0080 Beta-tent PF04828 GFA Glutathione-dependent formaldehyde-activating enzyme
Representative CDS sequence
>Lus10018517 pacid=23180513 polypeptide=Lus10018517 locus=Lus10018517.g ID=Lus10018517.BGIv1.0 annot-version=v1.0
ATGGAGGATGAAGAATTGGTGATTCACAGCGGTGGATGCCATTGTGGGAAGATAAGATGGCGAGTTCAAGCACCACGGAGCGTGGTAGCTTGGAAATGCA
ACTGTTCGGATTGTTCCATGAGAGGGAATGTTCATTTCATTGTTCCTTCCCACAGTTTCGAGCTTCTGGGTGATTCTCAAAGTTACGTTACCACCTATAC
CTTTGGCACTCACACTGCGAAACACACCTTCTGCAAAGTCCGTGGGATCACTTCGTACTACATTCCAAGATCGAATCCGGATGGTGTTGCGGTTACTTTC
AGGTGCGTGGATCCTGGAACTCTTACACATATCGAGATCAAGGATTTTGATGGCAAGAATTGGGATAGCTCCTATTCTCAGACCGGCATTGCCTCGTGCT
CCAAGGATCGAACTTCTTAA
AA sequence
>Lus10018517 pacid=23180513 polypeptide=Lus10018517 locus=Lus10018517.g ID=Lus10018517.BGIv1.0 annot-version=v1.0
MEDEELVIHSGGCHCGKIRWRVQAPRSVVAWKCNCSDCSMRGNVHFIVPSHSFELLGDSQSYVTTYTFGTHTAKHTFCKVRGITSYYIPRSNPDGVAVTF
RCVDPGTLTHIEIKDFDGKNWDSSYSQTGIASCSKDRTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G16940 carbon-sulfur lyases (.1.2) Lus10018517 0 1
AT5G16940 carbon-sulfur lyases (.1.2) Lus10000116 1.0 0.9754
AT4G35640 ATSERAT3;2 serine acetyltransferase 3;2 (... Lus10007424 9.8 0.7257
AT4G37460 SRFR1 SUPPRESSOR OF RPS4-RLD 1, Tetr... Lus10014863 10.4 0.7776
AT1G10760 GWD1, GWD, SOP1... STARCH EXCESS 1, Pyruvate phos... Lus10013044 14.0 0.7975
AT1G47270 TUB AtTLP6 tubby like protein 6 (.1.2) Lus10010833 14.8 0.7335
AT2G28880 ADCS, EMB1997 embryo defective 1997, aminode... Lus10036525 19.7 0.7353
AT3G22470 Pentatricopeptide repeat (PPR)... Lus10003426 22.6 0.7258
AT5G47900 Protein of unknown function (D... Lus10014112 23.6 0.7616
AT5G23540 Mov34/MPN/PAD-1 family protein... Lus10011716 24.2 0.7414
AT3G13050 AtNiaP nicotinate transporter, Major ... Lus10033842 26.5 0.7360

Lus10018517 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.