Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28240 69 / 8e-17 Wound-responsive family protein (.1) AT4G10265 37 / 0.0002 Wound-responsive family protein (.1) AT4G10270 37 / 0.0003 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039758 [exp] 154 / 1e-50 AT4G28240 59 / 5e-13 Wound-responsive family protein (.1) Lus10031617 [exp] 118 / 3e-36 AT4G28240 72 / 4e-18 Wound-responsive family protein (.1) Lus10033728 [exp] 104 / 6e-31 AT4G28240 54 / 2e-11 Wound-responsive family protein (.1) Lus10027667 [exp] 72 / 4e-18 ND / Lus10039755 [exp] 49 / 4e-09 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10039751 [exp] 49 / 6e-09 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1) Lus10018533 [exp] 45 / 1e-07 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10018530 [exp] 39 / 3e-05 AT4G10270 119 / 8e-37 Wound-responsive family protein (.1) Lus10018532 [exp] 38 / 0.0001 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G147700 [exp] 88 / 2e-24 AT4G28240 63 / 1e-14 Wound-responsive family protein (.1) Potri.019G116300 [exp] 59 / 3e-13 AT4G28240 / Wound-responsive family protein (.1) Potri.019G117500 [exp] 51 / 5e-10 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117402 [exp] 51 / 5e-10 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G116932 [exp] 51 / 7e-10 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117100 [exp] 51 / 7e-10 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117632 [exp] 51 / 9e-10 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G116866 [exp] 47 / 2e-08 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G117201 [exp] 47 / 2e-08 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G117200 [exp] 47 / 2e-08 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10018535 pacid=23180433 polypeptide=Lus10018535 locus=Lus10018535.g ID=Lus10018535.BGIv1.0 annot-version=v1.0 ATGAATCAACTGAACAAAGTCTGGACGGCGGCCGCAGTAGCAGTAGCACAGGGGCATCCGAAGGAGCAGGGGACTAAGTGGAGATCCTGCTTGCAGTCTC TCCACCACGGCAAGAGGCAGATGTTCTCCGGCGCCGGCGATGGCTCCGATCTTCGACCTCTTGCTGCTTCCGCGACGGTCGGATCTGATCCTTCCGACTT AGCGAGGCAGACTGACGAGTCGATGAGACGAGTCATGTACATGAACTGCTGGGGACAGGTGTGA
AA sequence Show only first row Show all	>Lus10018535 pacid=23180433 polypeptide=Lus10018535 locus=Lus10018535.g ID=Lus10018535.BGIv1.0 annot-version=v1.0 MNQLNKVWTAAAVAVAQGHPKEQGTKWRSCLQSLHHGKRQMFSGAGDGSDLRPLAASATVGSDPSDLARQTDESMRRVMYMNCWGQV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28240			Wound-responsive family protei...		Lus10018535 [exp]	0	1
AT4G22330		ATCES1	Alkaline phytoceramidase (aPHC...		Lus10032605 [exp]	3.9	0.8281
AT5G08290		YLS8	YELLOW-LEAF-SPECIFIC GENE 8, m...		Lus10010188 [exp]	4.8	0.8500
AT5G47890			NADH-ubiquinone oxidoreductase...		Lus10003023 [exp]	6.0	0.8143
AT4G04780		MED21	mediator 21 (.1)		Lus10008009 [exp]	6.9	0.8021
AT1G71950			Proteinase inhibitor, propepti...		Lus10038252 [exp]	9.6	0.8284
AT1G44170		ALDH4, ALDH3H1	aldehyde dehydrogenase 4, alde...		Lus10018153 [exp]	12.8	0.7873
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10002738 [exp]	13.0	0.7889
AT1G14140			Mitochondrial substrate carrie...		Lus10030443 [exp]	17.2	0.7970
AT1G56423			unknown protein		Lus10029844 [exp]	17.3	0.8044
AT3G07760			Sterile alpha motif (SAM) doma...		Lus10001743 [exp]	17.5	0.7944

Compare expression of checked genes

Lus10018535 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.