Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039759 [exp] 206 / 1e-70 ND / Lus10033891 [exp] 43 / 1e-06 ND / Lus10003555 [exp] 43 / 2e-06 ND / Lus10024888 [exp] 44 / 3e-06 AT2G36070 445 / 8e-154 translocase inner membrane subunit 44-2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G106900 [exp] 56 / 2e-11 ND / Potri.005G061780 [exp] 54 / 1e-10 ND / Potri.007G117900 [exp] 42 / 3e-06 ND / Potri.007G109600 [exp] 40 / 1e-05 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018536 pacid=23180453 polypeptide=Lus10018536 locus=Lus10018536.g ID=Lus10018536.BGIv1.0 annot-version=v1.0 ATGGCAGATTTCAACAGCAAAGCAGCGTTCTTTCTCGCTCTGGTACTGATAATCTCCAACGCTGTCACCTTCTCCGCCGCCATAAACAGCCAGCTTCCAT TTGATGGAGTTGGGTATATGTCGCATTTCCAGTGCCGGGAACAGTACACGGCCAAGGACGGCGAGCGGTGCTCCGAGGTAGCTCGAAAGTATAAAATGAG CGATGAGTATTTCAACTTGATCAACCCGAAAGTGAATTGTCCAGGGCTTCTCAAAGGGCAGCTCATCTGCACCAAAGCTTCTGTTAAGGGTTTCAGATGA
AA sequence Show only first row Show all	>Lus10018536 pacid=23180453 polypeptide=Lus10018536 locus=Lus10018536.g ID=Lus10018536.BGIv1.0 annot-version=v1.0 MADFNSKAAFFLALVLIISNAVTFSAAINSQLPFDGVGYMSHFQCREQYTAKDGERCSEVARKYKMSDEYFNLINPKVNCPGLLKGQLICTKASVKGFR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018536 [exp]	0	1
AT2G42280	bHLH	bHLH130	basic helix-loop-helix (bHLH) ...		Lus10037484 [exp]	7.0	0.8546
AT4G31970		CYP82C2, JAH1	"cytochrome P450, family 82, s...		Lus10010758 [exp]	15.7	0.8516
AT1G11340			S-locus lectin protein kinase ...		Lus10036139 [exp]	21.8	0.8515
AT5G39590			TLD-domain containing nucleola...		Lus10024317 [exp]	24.4	0.7721
AT2G27410	B3		Domain of unknown function (DU...		Lus10027284 [exp]	25.4	0.8509
AT1G57790			F-box family protein (.1)		Lus10004476 [exp]	26.5	0.8504
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10031748 [exp]	27.0	0.7883
					Lus10013654 [exp]	28.5	0.8467
AT1G03940			HXXXD-type acyl-transferase fa...		Lus10012743 [exp]	31.1	0.8455
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10028145 [exp]	32.1	0.8470

Compare expression of checked genes

Lus10018536 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.