Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G19130 110 / 4e-29 S-locus lectin protein kinase family protein (.1) AT5G24080 79 / 3e-18 Protein kinase superfamily protein (.1) AT1G34300 70 / 5e-15 lectin protein kinase family protein (.1) AT4G32300 70 / 6e-15 SD2-5 S-domain-2 5 (.1) AT4G00340 69 / 2e-14 RLK4 receptor-like protein kinase 4 (.1) AT1G70250 68 / 2e-14 receptor serine/threonine kinase, putative (.1) AT5G35370 68 / 3e-14 S-locus lectin protein kinase family protein (.1) AT1G29730 67 / 6e-14 Leucine-rich repeat transmembrane protein kinase (.1) AT2G41890 67 / 7e-14 curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein (.1) AT4G23280 62 / 4e-12 CRK20 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039762 [exp] 207 / 9e-64 AT2G19130 621 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10039732 [exp] 202 / 4e-62 AT2G19130 647 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10033748 [exp] 121 / 7e-33 AT2G19130 711 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10031597 [exp] 110 / 3e-32 AT2G19130 145 / 3e-41 S-locus lectin protein kinase family protein (.1) Lus10029802 [exp] 109 / 7e-29 AT2G19130 729 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10042266 [exp] 100 / 9e-26 AT2G19130 775 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10013659 [exp] 84 / 1e-20 AT5G20050 244 / 8e-79 Protein kinase superfamily protein (.1) Lus10026391 [exp] 75 / 1e-18 AT2G19130 89 / 4e-22 S-locus lectin protein kinase family protein (.1) Lus10033032 [exp] 79 / 5e-18 AT5G20050 483 / 4e-169 Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G119200 [exp] 105 / 2e-27 AT2G19130 874 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.013G121000 [exp] 99 / 3e-25 AT2G19130 863 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.013G149500 [exp] 96 / 4e-24 AT2G19130 838 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.014G086900 [exp] 82 / 5e-19 AT4G00340 862 / 0.0 receptor-like protein kinase 4 (.1) Potri.015G026300 [exp] 77 / 2e-17 AT5G24080 684 / 0.0 Protein kinase superfamily protein (.1) Potri.019G086300 [exp] 77 / 2e-17 AT1G34300 847 / 0.0 lectin protein kinase family protein (.1) Potri.019G086400 [exp] 76 / 3e-17 AT1G34300 904 / 0.0 lectin protein kinase family protein (.1) Potri.013G115700 [exp] 76 / 5e-17 AT1G34300 939 / 0.0 lectin protein kinase family protein (.1) Potri.013G115800 [exp] 76 / 5e-17 AT1G34300 858 / 0.0 lectin protein kinase family protein (.1) Potri.018G027300 [exp] 74 / 1e-16 AT4G32300 1012 / 0.0 S-domain-2 5 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018537 pacid=23180359 polypeptide=Lus10018537 locus=Lus10018537.g ID=Lus10018537.BGIv1.0 annot-version=v1.0 ATGGCTTTCGGGGGAGGCGATTACGGCGAAAGCTGTTGGAGCTACGGGATGGTGCTGTTGGACCTAGTATCCGGAATGAGAAACTCGCAACGACATGTAT GTATCGGTCACTACTTTCCTGTTTGGGTAGCGAATGTGATAAACGAAGGTGGGGATTTGGCTGAGGTGCTGGATCCAAGGTTACAAGGGAATGCTGATGG TGAAGAGTTGGAAAGAGTCTGTAGAGTTGCTGTTTGGTGCATTCAGGACGACGAAAGTAATCGCCCGACTATGAGTCAGGTAGTTTACATTCTTGAACAG GTATTGGGAGTGGATATTCCTCCTGTTCCGAGTATTCTTCTGAGATATGTTGATCCTGACAGATAG
AA sequence Show only first row Show all	>Lus10018537 pacid=23180359 polypeptide=Lus10018537 locus=Lus10018537.g ID=Lus10018537.BGIv1.0 annot-version=v1.0 MAFGGGDYGESCWSYGMVLLDLVSGMRNSQRHVCIGHYFPVWVANVINEGGDLAEVLDPRLQGNADGEELERVCRVAVWCIQDDESNRPTMSQVVYILEQ VLGVDIPPVPSILLRYVDPDR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G19130			S-locus lectin protein kinase ...		Lus10018537 [exp]	0	1
AT4G15720			Tetratricopeptide repeat (TPR)...		Lus10006517 [exp]	1.7	0.8054
AT1G22620		ATSAC1	suppressor of actin 1, Phospho...		Lus10016941 [exp]	6.3	0.8420
AT3G42150			unknown protein		Lus10031451 [exp]	7.9	0.7848
AT2G39260			binding;RNA binding (.1)		Lus10030801 [exp]	8.1	0.8155
AT1G31860		HISN2, AT-IE	HISTIDINE BIOSYNTHESIS 2, hist...		Lus10043483 [exp]	9.2	0.7954
AT4G15720			Tetratricopeptide repeat (TPR)...		Lus10037505 [exp]	11.2	0.7638
AT1G65390		ATPP2-A5	phloem protein 2 A5 (.1.2)		Lus10018301 [exp]	12.5	0.8001
AT4G32790			Exostosin family protein (.1)		Lus10014425 [exp]	14.1	0.7885
AT2G26650		AKT1, ATAKT1	K+ transporter 1, K+ transport...		Lus10017765 [exp]	19.0	0.7813
AT5G39960			GTP binding;GTP binding (.1)		Lus10033794 [exp]	19.3	0.7784

Compare expression of checked genes

Lus10018537 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.