Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35635 51 / 4e-09 UBQ7, RUB2 RELATED TO UBIQUITIN 2, ubiquitin 7 (.1) AT1G31340 51 / 5e-09 NEDD8, ATRUB1, RUB1 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) AT3G52590 50 / 1e-08 HAP4, ERD16, UBQ1, EMB2167 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) AT2G36170 50 / 1e-08 Ubiquitin supergroup;Ribosomal protein L40e (.1) AT4G05050 49 / 3e-08 UBQ11 ubiquitin 11 (.1.2.3.4) AT4G02890 49 / 7e-08 UBQ14 Ubiquitin family protein (.1.2.3.4) AT1G65350 49 / 8e-08 UBQ13 ubiquitin 13 (.1) AT1G23410 48 / 8e-08 Ribosomal protein S27a / Ubiquitin family protein (.1) AT4G05320 49 / 9e-08 UBQ10 polyubiquitin 10 (.1.2.3.4.5.6) AT5G03240 49 / 9e-08 UBQ3 polyubiquitin 3 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039763 [exp] 99 / 7e-28 ND / Lus10008873 [exp] 50 / 1e-08 AT3G52590 261 / 5e-92 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Lus10018367 [exp] 49 / 8e-08 AT4G05320 452 / 4e-164 polyubiquitin 10 (.1.2.3.4.5.6) Lus10030894 [exp] 48 / 1e-07 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Lus10030595 [exp] 48 / 1e-07 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G062500 [exp] 51 / 5e-09 AT1G31340 296 / 9e-105 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) Potri.005G198700 [exp] 51 / 5e-09 AT1G31340 293 / 1e-103 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) Potri.016G077000 [exp] 50 / 5e-09 AT3G52590 194 / 1e-65 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.005G096700 [exp] 51 / 6e-09 AT1G31340 270 / 2e-94 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) Potri.016G077200 [exp] 50 / 1e-08 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.012G024300 [exp] 50 / 1e-08 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.015G007100 [exp] 50 / 1e-08 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.016G088100 [exp] 48 / 4e-08 AT4G05050 207 / 3e-70 ubiquitin 11 (.1.2.3.4) Potri.011G026600 [exp] 49 / 7e-08 AT4G05050 452 / 3e-164 ubiquitin 11 (.1.2.3.4) Potri.017G135600 [exp] 49 / 8e-08 AT4G02890 597 / 0.0 Ubiquitin family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF00240 [flax] [poplar] ubiquitin Ubiquitin family
Representative CDS sequence Show only first row Show all	>Lus10018538 pacid=23180425 polypeptide=Lus10018538 locus=Lus10018538.g ID=Lus10018538.BGIv1.0 annot-version=v1.0 ATGATATTCGCTGGCAATCAGCTGGAGGGTGGAAGGACATTGGCCGATTACAACATCCACAACAACTCCACTCTCCATTCTTCTCTAGTTACAAGCACTG GTACCATCAACAAGCCGGGAAGAGGGAAGAAATCTGGAGGAGTTCTTGGTGCCAGAAAGCTCAGCAGTGCCTTGGCCGCAAACCCATTCTCCAACGAAGA GGCGTTTGCAAGGAAGATTCGGGTTGAGAGCTTTGAACAAGTTCAGACTCTTTGCGTTCGATCTAGCAATGCTGAAACATGTATCCCCTGCCTCCACCGC CACAGCTCGAACACATTTGATTTTACAGCCGCCTGA
AA sequence Show only first row Show all	>Lus10018538 pacid=23180425 polypeptide=Lus10018538 locus=Lus10018538.g ID=Lus10018538.BGIv1.0 annot-version=v1.0 MIFAGNQLEGGRTLADYNIHNNSTLHSSLVTSTGTINKPGRGKKSGGVLGARKLSSALAANPFSNEEAFARKIRVESFEQVQTLCVRSSNAETCIPCLHR HSSNTFDFTAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G35635		UBQ7, RUB2	RELATED TO UBIQUITIN 2, ubiqui...		Lus10018538 [exp]	0	1
AT3G17220		ATPMEI2	pectin methylesterase inhibito...		Lus10023114 [exp]	14.0	0.9494
AT1G70580		GGT2, AOAT2	GLUTAMATE:GLYOXYLATE AMINOTRAN...		Lus10036850 [exp]	20.3	0.9445
					Lus10013528 [exp]	24.5	0.9440
AT4G35150			O-methyltransferase family pro...		Lus10017699 [exp]	28.8	0.9437
					Lus10010593 [exp]	32.2	0.9424
					Lus10039439 [exp]	35.5	0.9416
					Lus10036646 [exp]	37.6	0.9415
AT1G72460			Leucine-rich repeat protein ki...		Lus10015678 [exp]	39.7	0.9415
AT1G02790		PGA4	polygalacturonase 4 (.1)		Lus10012489 [exp]	43.0	0.9409
AT3G44540		FAR4	fatty acid reductase 4 (.1.2)		Lus10019187 [exp]	46.0	0.9408

Compare expression of checked genes

Lus10018538 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.