Lus10018542 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28390 81 / 3e-18 Protein kinase superfamily protein (.1.2)
AT1G17230 52 / 3e-08 Leucine-rich receptor-like protein kinase family protein (.1)
AT1G77280 51 / 6e-08 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT5G65530 50 / 7e-08 Protein kinase superfamily protein (.1)
AT3G59750 50 / 1e-07 Concanavalin A-like lectin protein kinase family protein (.1)
AT1G53730 49 / 2e-07 SRF6 STRUBBELIG-receptor family 6 (.1.2)
AT1G76370 49 / 3e-07 Protein kinase superfamily protein (.1)
AT1G07870 49 / 3e-07 Protein kinase superfamily protein (.1.2)
AT1G16670 48 / 4e-07 Protein kinase superfamily protein (.1)
AT2G20850 48 / 4e-07 SRF1 STRUBBELIG-receptor family 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039770 149 / 2e-43 AT1G28390 379 / 2e-127 Protein kinase superfamily protein (.1.2)
Lus10016371 61 / 2e-11 AT3G51990 402 / 3e-138 Protein kinase superfamily protein (.1)
Lus10018959 54 / 7e-09 AT3G05140 512 / 8e-180 ROP binding protein kinases 2 (.1)
Lus10025713 53 / 1e-08 AT5G65530 461 / 8e-161 Protein kinase superfamily protein (.1)
Lus10019600 52 / 2e-08 AT1G61420 71 / 1e-18 S-locus lectin protein kinase family protein (.1)
Lus10040021 52 / 3e-08 AT4G19810 278 / 5e-89 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1)
Lus10005103 51 / 7e-08 AT5G16000 998 / 0.0 NSP-interacting kinase 1 (.1)
Lus10034350 50 / 7e-08 AT5G16000 1018 / 0.0 NSP-interacting kinase 1 (.1)
Lus10035949 50 / 9e-08 AT5G65530 521 / 0.0 Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G158600 84 / 9e-20 AT1G28390 397 / 3e-134 Protein kinase superfamily protein (.1.2)
Potri.001G260800 58 / 2e-10 AT3G51990 419 / 5e-146 Protein kinase superfamily protein (.1)
Potri.009G055200 55 / 2e-09 AT3G51990 409 / 7e-141 Protein kinase superfamily protein (.1)
Potri.004G221800 55 / 2e-09 AT5G23170 273 / 1e-89 Protein kinase superfamily protein (.1)
Potri.003G010300 52 / 1e-08 AT5G23170 270 / 3e-88 Protein kinase superfamily protein (.1)
Potri.010G228200 51 / 5e-08 AT3G47570 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.004G037000 51 / 5e-08 AT4G03390 645 / 0.0 STRUBBELIG-receptor family 3 (.1)
Potri.014G136300 49 / 3e-07 AT5G35960 556 / 0.0 Protein kinase family protein (.1)
Potri.003G150000 49 / 4e-07 AT3G47570 506 / 4e-162 Leucine-rich repeat protein kinase family protein (.1)
Potri.005G185500 48 / 4e-07 AT5G56790 348 / 1e-111 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10018542 pacid=23180373 polypeptide=Lus10018542 locus=Lus10018542.g ID=Lus10018542.BGIv1.0 annot-version=v1.0
ATGGGTTGTCTTCCTTGCAATGCTGACTCCGCCGTCGCAATCTGCGGCGACGGTCGATCTCACCATAACAAACCCACATCAACCACCACCAAGCACTTCA
CTTACTCCGAATTAGTCGCCGCCACCGGTGACTTCTCCGCCGACAACTTCCTCGGAAAGGGTAGCCACGGAGCTGTTTACAAAGCCACCCTCGACGGCGG
TAAGCTGATCGCCGCCGTCAAACGGAACAGCCATCCAGCGATATGGTCCCCCTCACATTGTTACCCAACCCCCCCCTCCAGGGGAAAAGCTGGTCCCCCC
CCGCAAACCGGACCAGCCACCACCAACCTCCGACCAATTTCAGAACGGCGCCGTCGCCGGCGGAGAACGAGATTGAGATCCTGTCGAAAGTCCGACACCC
GAGGTTGGTCAACCTCATCGGCTTCTGCGCCGAGCGGAGATTAA
AA sequence
>Lus10018542 pacid=23180373 polypeptide=Lus10018542 locus=Lus10018542.g ID=Lus10018542.BGIv1.0 annot-version=v1.0
MGCLPCNADSAVAICGDGRSHHNKPTSTTTKHFTYSELVAATGDFSADNFLGKGSHGAVYKATLDGGKLIAAVKRNSHPAIWSPSHCYPTPPSRGKAGPP
PQTGPATTNLRPISERRRRRRRTRLRSCRKSDTRGWSTSSASAPSGD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G28390 Protein kinase superfamily pro... Lus10018542 0 1
AT1G65890 AAE12 acyl activating enzyme 12 (.1) Lus10020787 2.4 0.8789
AT5G20420 CHR42 chromatin remodeling 42 (.1) Lus10040956 3.6 0.9116
AT4G32780 phosphoinositide binding (.1) Lus10009508 5.7 0.8733
AT4G03390 SRF3 STRUBBELIG-receptor family 3 (... Lus10011223 6.6 0.8821
AT5G43810 PNH, ZLL, AGO10 ZWILLE, PINHEAD, ARGONAUTE 10,... Lus10039386 9.5 0.8711
AT2G42200 SBP SPL9, AtSPL9 squamosa promoter binding prot... Lus10012020 11.0 0.8724
Lus10039387 11.2 0.8702
AT1G75240 ZF_HD ATHB33, ZHD5 zinc-finger homeodomain 5, hom... Lus10026010 12.0 0.8698
AT1G69440 ZIP, AGO7 ZIPPY, ARGONAUTE7, Argonaute f... Lus10036794 14.4 0.8439
AT2G18360 alpha/beta-Hydrolases superfam... Lus10025873 14.8 0.8508

Lus10018542 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.