Lus10018557 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20830 125 / 4e-35 transferases;folic acid binding (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039788 263 / 5e-92 AT2G20830 132 / 2e-37 transferases;folic acid binding (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G145800 221 / 2e-75 AT2G20830 137 / 2e-39 transferases;folic acid binding (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0255 ATP_synthase PF09811 Yae1_N Essential protein Yae1, N terminal
Representative CDS sequence
>Lus10018557 pacid=23180468 polypeptide=Lus10018557 locus=Lus10018557.g ID=Lus10018557.BGIv1.0 annot-version=v1.0
ATGGATTCAGGATCTCAATCAGGAGACATATTTGAATCCTCATTGAATCTGGAGGAGATGCATTACAGAGAAGGGTACAATGAAGGGCACAGCGATGGCC
TAGTTGCTGGCAAAGAAGAGGCCAAACAAGTTGGCTTGAAAACTGGGTTCGAAACCGGGGAGGAACTCGGGTTCTACCGTGGTTGCATTGATCTCTGGAA
CTCGGCAATGCTGGTTGCCCCGACACATTTCTCATCCCGACTCCAGAAGACGATAAAGCAAATGGAGCAACTCATTGTCCAATACCCGCTTCTGGATCCT
GAGGATGAGAGAGTTCAGGCTATGATGGATAGTCTGAGGTTGAAGATCCGGGTCATAAGAGCCGGTCTCGGTGTGAAGTTGGAGTATGACGGATATCCAA
AGCCTCAAGAAATGGAATTTTGA
AA sequence
>Lus10018557 pacid=23180468 polypeptide=Lus10018557 locus=Lus10018557.g ID=Lus10018557.BGIv1.0 annot-version=v1.0
MDSGSQSGDIFESSLNLEEMHYREGYNEGHSDGLVAGKEEAKQVGLKTGFETGEELGFYRGCIDLWNSAMLVAPTHFSSRLQKTIKQMEQLIVQYPLLDP
EDERVQAMMDSLRLKIRVIRAGLGVKLEYDGYPKPQEMEF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20830 transferases;folic acid bindin... Lus10018557 0 1
AT1G06730 pfkB-like carbohydrate kinase ... Lus10024866 4.8 0.8340
Lus10008149 6.9 0.7788
AT5G50280 EMB1006 embryo defective 1006, Pentatr... Lus10018086 12.6 0.7946
AT5G15710 Galactose oxidase/kelch repeat... Lus10035147 24.2 0.7492
AT1G15510 VAC1, ATECB2 VANILLA CREAM 1, ARABIDOPSIS E... Lus10026460 26.1 0.7746
AT1G01970 Tetratricopeptide repeat (TPR)... Lus10015864 31.0 0.7401
AT1G17880 ATBTF3 basic transcription factor 3 (... Lus10039661 36.3 0.7527
AT5G07320 APC3 ATP/phosphate carrier 3, Mitoc... Lus10032523 41.9 0.7686
AT1G09620 ATP binding;leucine-tRNA ligas... Lus10025653 42.1 0.7432
AT4G02990 RUG2, BSM RUGOSA 2, BELAYA SMERT, Mitoch... Lus10022321 45.8 0.7509

Lus10018557 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.