Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20835 85 / 1e-23 unknown protein AT3G15534 79 / 1e-21 unknown protein AT1G52855 78 / 6e-21 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039793 [exp] 102 / 1e-30 AT2G20835 115 / 7e-36 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G405400 [exp] 86 / 4e-24 AT1G52855 85 / 9e-24 unknown protein Potri.019G104300 [exp] 81 / 2e-22 AT1G52855 116 / 2e-36 unknown protein Potri.019G104100 [exp] 81 / 2e-22 AT1G52855 116 / 2e-36 unknown protein Potri.011G124800 [exp] 81 / 4e-22 AT1G52855 119 / 1e-37 unknown protein Potri.013G145100 [exp] 80 / 6e-22 AT1G52855 112 / 2e-34 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018561 pacid=23180459 polypeptide=Lus10018561 locus=Lus10018561.g ID=Lus10018561.BGIv1.0 annot-version=v1.0 ATGGCGGTGTTCTGTTTTCTAGTGGATCAGAGGCAGATAATGAGGAGCAGCAAGCCGGCGGCGGGATCCTGCTCGAGGTGCGGCGGCGGAGCAAGCATCG CCGACATGAGGACCAGCACCAGGTTCTGCTACGTCCCCTTCTACCGGAAGTCGTGGCGGGCCATCATCTGCACCTTCTGCGGCTCCGTCCTCCGTTCTTA CCGATGA
AA sequence Show only first row Show all	>Lus10018561 pacid=23180459 polypeptide=Lus10018561 locus=Lus10018561.g ID=Lus10018561.BGIv1.0 annot-version=v1.0 MAVFCFLVDQRQIMRSSKPAAGSCSRCGGGASIADMRTSTRFCYVPFYRKSWRAIICTFCGSVLRSYR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20835			unknown protein		Lus10018561 [exp]	0	1
AT2G20835			unknown protein		Lus10039793 [exp]	1.4	0.9133
AT1G33100			MATE efflux family protein (.1...		Lus10005685 [exp]	2.8	0.8946
AT2G37540			NAD(P)-binding Rossmann-fold s...		Lus10023762 [exp]	3.0	0.9331
AT3G24420			alpha/beta-Hydrolases superfam...		Lus10017735 [exp]	11.2	0.9032
AT2G25770			Polyketide cyclase/dehydrase a...		Lus10040227 [exp]	18.5	0.8433
AT3G45740			hydrolase family protein / HAD...		Lus10023480 [exp]	19.9	0.8496
AT5G45170			Haloacid dehalogenase-like hyd...		Lus10018280 [exp]	20.4	0.8613
AT3G18430			Calcium-binding EF-hand family...		Lus10029670 [exp]	21.8	0.8709
AT4G18770	MYB	ATMYB98	myb domain protein 98 (.1)		Lus10042111 [exp]	22.1	0.8813
AT2G04570			GDSL-like Lipase/Acylhydrolase...		Lus10031520 [exp]	22.7	0.8840

Compare expression of checked genes

Lus10018561 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.