Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11120 69 / 1e-15 unknown protein AT1G09812 50 / 5e-09 unknown protein AT4G28170 46 / 4e-07 unknown protein AT1G58007 42 / 6e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039796 [exp] 155 / 3e-50 AT1G11120 122 / 3e-36 unknown protein Lus10011221 [exp] 71 / 1e-16 AT1G11120 121 / 8e-36 unknown protein Lus10018462 [exp] 69 / 5e-16 AT1G11120 122 / 3e-36 unknown protein Lus10037361 [exp] 57 / 4e-11 AT1G09812 97 / 2e-26 unknown protein Lus10035787 [exp] 56 / 9e-11 AT1G09812 96 / 8e-26 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G037200 [exp] 94 / 1e-25 AT1G11120 147 / 9e-46 unknown protein Potri.019G103800 [exp] 92 / 5e-25 AT1G11120 119 / 5e-35 unknown protein Potri.011G045900 [exp] 87 / 4e-23 AT1G11120 133 / 2e-40 unknown protein Potri.004G224200 [exp] 56 / 4e-11 AT1G09812 118 / 4e-35 unknown protein Potri.003G006900 [exp] 55 / 1e-10 AT1G09812 105 / 6e-30 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018564 pacid=23180379 polypeptide=Lus10018564 locus=Lus10018564.g ID=Lus10018564.BGIv1.0 annot-version=v1.0 ATGGGGGTCGACGGCAGCTGGATTACAGTCCCACCGGAGACGGCGGCGATGAGCTCGGATAGGGCGGAAGATCACTGGAGGCATTTCGACAACTCGGTTG ATGCGGTGTCGTTTGGATTCGTCGCTACTGCGATTCTCATTTCAATGTTCTTGGTCATGGCTATCTTCGAACGGTTTCTCCGGCCGAGATCGTCTCTCAA TCCTTCCTCTCCTCCTTCCTCCTCACGTCCGGTTGATCTCGAGGCGCAGTTCGGATTCAACGGCAAGCTTACTAATTACCCATCTCCAAAGGTACAATCT TTTCCTCTGTGCTCATATCATATGTCTCTGTTTTAG
AA sequence Show only first row Show all	>Lus10018564 pacid=23180379 polypeptide=Lus10018564 locus=Lus10018564.g ID=Lus10018564.BGIv1.0 annot-version=v1.0 MGVDGSWITVPPETAAMSSDRAEDHWRHFDNSVDAVSFGFVATAILISMFLVMAIFERFLRPRSSLNPSSPPSSSRPVDLEAQFGFNGKLTNYPSPKVQS FPLCSYHMSLF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11120			unknown protein		Lus10018564 [exp]	0	1
AT2G38370			Plant protein of unknown funct...		Lus10025249 [exp]	2.4	0.9295
AT2G39870			unknown protein		Lus10040247 [exp]	3.5	0.9194
AT2G27990	HD	PNF, BLH8	POUND-FOOLISH, BEL1-like homeo...		Lus10016110 [exp]	4.6	0.9185
AT5G62740		AtHIR4, ATHIR1	hypersensitive induced reactio...		Lus10007268 [exp]	4.9	0.9059
AT3G57070			Glutaredoxin family protein (....		Lus10042021 [exp]	6.9	0.8945
AT4G37750	AP2_ERF	DRG, CKC1, ANT	DRAGON, COMPLEMENTING A PROTEI...		Lus10007719 [exp]	7.7	0.9106
AT4G37750	AP2_ERF	DRG, CKC1, ANT	DRAGON, COMPLEMENTING A PROTEI...		Lus10018655 [exp]	7.7	0.9132
AT3G48970			Heavy metal transport/detoxifi...		Lus10027470 [exp]	8.8	0.8919
AT3G51670			SEC14 cytosolic factor family ...		Lus10001269 [exp]	8.9	0.8983
AT4G00820		IQD17	IQ-domain 17 (.1)		Lus10023233 [exp]	9.4	0.9020

Compare expression of checked genes

Lus10018564 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.