Lus10018566 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10018566 pacid=23180411 polypeptide=Lus10018566 locus=Lus10018566.g ID=Lus10018566.BGIv1.0 annot-version=v1.0
ATGAAACATTTCCAAGATGAAGACGCATGCCTTACTTTTGCATCTGCAGCTTGTTTCTTGTACTGCTGGCTGGCTCTTTCCTCTGAACAAAGACAGGAAA
AGATTGCAACTTTTCGTTCTAGATTCTTAAAACAAAAGGAAACGTGTGTTTTGGTTTGTGATCATAAGCTATGCTGTAAATATCTAATCATCTGTGGGGT
TATGGAACAATCGGACCCTGAGGCGAAACCGGGGCCTATCAGGGACATATTATCAAAGCCACAAGTGGGGAAGAAAGAAAGCTATGGTCCTCAGTACCAA
AGCAGCACTCACATCACCAAACTAGTTGGAGCATTGGAGCTGGATTTTAATGCCGTGTCTTGCTTCCTCAACACAAAAAGAGGTCTTGCTCTTTCTTCAT
TTCACTAG
AA sequence
>Lus10018566 pacid=23180411 polypeptide=Lus10018566 locus=Lus10018566.g ID=Lus10018566.BGIv1.0 annot-version=v1.0
MKHFQDEDACLTFASAACFLYCWLALSSEQRQEKIATFRSRFLKQKETCVLVCDHKLCCKYLIICGVMEQSDPEAKPGPIRDILSKPQVGKKESYGPQYQ
SSTHITKLVGALELDFNAVSCFLNTKRGLALSSFH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10018566 0 1
AT3G53180 NodGS nodulin/glutamine synthase-lik... Lus10023908 3.2 0.8640
AT3G27670 RST1 RESURRECTION1, ARM repeat supe... Lus10010374 3.2 0.8912
AT2G20725 CAAX amino terminal protease f... Lus10039818 9.6 0.7912
AT5G05670 signal recognition particle bi... Lus10013031 9.8 0.8556
Lus10006003 11.2 0.8500
AT5G67380 ATCKA1, CKA1 casein kinase alpha 1 (.1.2) Lus10032849 12.1 0.8624
AT1G49350 pfkB-like carbohydrate kinase ... Lus10009862 16.9 0.8419
AT1G16670 Protein kinase superfamily pro... Lus10028149 17.5 0.8478
AT2G46910 Plastid-lipid associated prote... Lus10010277 20.9 0.8319
AT5G37290 ARM repeat superfamily protein... Lus10008435 22.5 0.8609

Lus10018566 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.