Lus10018569 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20870 39 / 7e-05 cell wall protein precursor, putative (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039801 143 / 5e-46 AT2G20870 39 / 7e-05 cell wall protein precursor, putative (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G144200 42 / 3e-06 AT2G20870 42 / 1e-05 cell wall protein precursor, putative (.1)
PFAM info
Representative CDS sequence
>Lus10018569 pacid=23180437 polypeptide=Lus10018569 locus=Lus10018569.g ID=Lus10018569.BGIv1.0 annot-version=v1.0
ATGGCTACCATGCATTCAAAAGCTTCTCTTTTGGCTCTCCTCATACTGCTCACTGTATCCAGCAGTCAAGTCCTCGCAGGCCGCCAAGCCCCCAGCAAGA
ATGAGGTCCTCGAACCAGAGAACTTAACCATCGCAGGGGTTCGTATCCCTCGATTCCGCATCCCTTCTTTCACCCCCTATACCGGTAATGGCAGATACAT
TCCAGGGAATGATGACACATTTGTTCCTAACCCTGGTTATGAGGTCCCCAATCCTAGCTACAGGGGTGGTCGTGGCAATCCTTGA
AA sequence
>Lus10018569 pacid=23180437 polypeptide=Lus10018569 locus=Lus10018569.g ID=Lus10018569.BGIv1.0 annot-version=v1.0
MATMHSKASLLALLILLTVSSSQVLAGRQAPSKNEVLEPENLTIAGVRIPRFRIPSFTPYTGNGRYIPGNDDTFVPNPGYEVPNPSYRGGRGNP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20870 cell wall protein precursor, p... Lus10018569 0 1
AT1G69850 NTL1, ATNRT1:2 nitrate transporter 1:2 (.1) Lus10005417 1.4 0.9511
AT2G20870 cell wall protein precursor, p... Lus10039801 1.4 0.9556
AT1G69850 NTL1, ATNRT1:2 nitrate transporter 1:2 (.1) Lus10015240 2.4 0.9315
AT1G11600 CYP77B1 "cytochrome P450, family 77, s... Lus10018350 2.8 0.9359
AT3G55150 ATEXO70H1 exocyst subunit exo70 family p... Lus10023455 3.2 0.9316
AT5G56170 LLG1 LORELEI-LIKE-GPI-ANCHORED PROT... Lus10010587 3.3 0.9108
AT5G20860 Plant invertase/pectin methyle... Lus10033621 4.9 0.9430
AT1G15360 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integr... Lus10002015 4.9 0.9194
AT1G04730 CTF18 CHROMOSOME TRANSMISSION FIDELI... Lus10032615 5.9 0.9222
AT3G43600 AtAO3, atAO-2, ... Arabidopsis thaliana aldehyde ... Lus10040474 6.2 0.8881

Lus10018569 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.