Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005498 [exp] 66 / 1e-14 AT5G11710 489 / 4e-166 ENTH/VHS family protein (.1) Lus10001995 [exp] 58 / 2e-13 ND / Lus10034530 [exp] 49 / 7e-10 ND / Lus10013036 [exp] 40 / 4e-06 ND / Lus10006988 [exp] 40 / 8e-06 ND / Lus10026710 [exp] 38 / 5e-05 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018571 pacid=23180444 polypeptide=Lus10018571 locus=Lus10018571.g ID=Lus10018571.BGIv1.0 annot-version=v1.0 ATGCAGTTCGTCGAACAAAATCCAGAAGACAGAAACCCTAATTTATCAAATTTGGGATTTTTCCTTCCGATTCATTTCATACCAGTGGACATCAGAGGTA ATGTTGAGGTAGTTCTTTTCCGATTCGCTCACCGAAACACGCATTGTGGAGCTAGCGACGTCATCACTTCCGAGTTTTAG
AA sequence Show only first row Show all	>Lus10018571 pacid=23180444 polypeptide=Lus10018571 locus=Lus10018571.g ID=Lus10018571.BGIv1.0 annot-version=v1.0 MQFVEQNPEDRNPNLSNLGFFLPIHFIPVDIRGNVEVVLFRFAHRNTHCGASDVITSEF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018571 [exp]	0	1
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10000843 [exp]	8.2	1.0000
AT5G35750		AHK2	histidine kinase 2 (.1)		Lus10009736 [exp]	11.4	1.0000
AT2G36870		XTH32	xyloglucan endotransglucosylas...		Lus10013823 [exp]	12.8	1.0000
AT4G22756		ATSMO1-2, ATSMO...	sterol C4-methyl oxidase 1-2 (...		Lus10028908 [exp]	16.7	1.0000
AT4G17260			Lactate/malate dehydrogenase f...		Lus10028931 [exp]	18.2	1.0000
AT1G07985			Expressed protein (.1)		Lus10029516 [exp]	19.4	1.0000
					Lus10009206 [exp]	21.0	1.0000
					Lus10016593 [exp]	23.3	1.0000
					Lus10017783 [exp]	24.6	1.0000
					Lus10016867 [exp]	24.9	1.0000

Compare expression of checked genes

Lus10018571 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.