Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65910 38 / 0.0005 NAC ANAC028 NAC domain containing protein 28 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039824 [exp] 52 / 2e-09 ND / Lus10001876 [exp] 52 / 1e-08 AT1G01470 178 / 3e-54 LIGHT STRESS-REGULATED 3, LATE EMBRYOGENESIS ABUNDANT 14, Late embryogenesis abundant protein (.1) Lus10022018 [exp] 47 / 1e-07 AT1G69490 58 / 6e-11 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10033279 [exp] 41 / 6e-05 AT5G62380 61 / 5e-10 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) Lus10033281 [exp] 40 / 0.0002 AT1G71930 57 / 4e-09 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1) Lus10033676 [exp] 39 / 0.0003 AT3G10480 72 / 4e-13 NAC domain containing protein 50 (.1.2.3) Lus10022965 [exp] 39 / 0.0004 AT2G24430 62 / 1e-10 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10017807 [exp] 0 / 1 ND 33 / 2e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G027900 [exp] 39 / 0.0003 AT2G24430 66 / 8e-12 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.015G002900 [exp] 38 / 0.0006 AT1G71930 71 / 2e-13 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10018591 pacid=23180427 polypeptide=Lus10018591 locus=Lus10018591.g ID=Lus10018591.BGIv1.0 annot-version=v1.0 ATGGCGGCGGCGGGAGTCAACCTCCGCCGCAACTTCGACCCGTCGGAGAAAGACCTGGTCAACTACCTCTGGCTGAAACTCAATGGACAAACCATCCCGA TTCCGTCCAATGAGTTCATACCGGAGATCGACATCTACGGACAGCTGAAGCCGTGGGAGATGTTCGACAGGAACGAGTCGGCCCGATTCTACGCTTTCGC GTGTCTGAAGAGCCGCGGCGGGCGGCGTCTCCGCTGTCCAGGCGTTTCCGCCGTTCCGCCGGCGGCGGAACGTGGGAGCTCAAGAACAGCACCCTGTTCG CAGAGGACGGCCGGTTTCTGA
AA sequence Show only first row Show all	>Lus10018591 pacid=23180427 polypeptide=Lus10018591 locus=Lus10018591.g ID=Lus10018591.BGIv1.0 annot-version=v1.0 MAAAGVNLRRNFDPSEKDLVNYLWLKLNGQTIPIPSNEFIPEIDIYGQLKPWEMFDRNESARFYAFACLKSRGGRRLRCPGVSAVPPAAERGSSRTAPCS QRTAGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018591 [exp]	0	1
AT5G52390			PAR1 protein (.1)		Lus10040714 [exp]	1.0	0.8359
AT3G09730			unknown protein		Lus10023175 [exp]	3.9	0.8100
AT1G04110		SDD1	STOMATAL DENSITY AND DISTRIBUT...		Lus10006704 [exp]	6.9	0.6911
					Lus10022865 [exp]	9.2	0.7413
AT1G04110		SDD1	STOMATAL DENSITY AND DISTRIBUT...		Lus10006702 [exp]	10.2	0.6463
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10042907 [exp]	10.2	0.8103
AT2G31180	MYB	ATMYB14, Myb14a...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10022021 [exp]	13.6	0.7839
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10009145 [exp]	14.3	0.6131
AT3G62710			Glycosyl hydrolase family prot...		Lus10034128 [exp]	14.5	0.6735
AT4G29340		PRF4	profilin 4 (.1)		Lus10012935 [exp]	15.2	0.7839

Compare expression of checked genes

Lus10018591 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.