Plant FIBer expression Database

Lus10018592 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28290 49 / 2e-09 unknown protein
AT5G42110 45 / 3e-08 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039825
[exp]
70 / 9e-18 AT4G28290 51 / 2e-10 unknown protein
Lus10031644
[exp]
61 / 4e-14 AT4G28290 59 / 2e-13 unknown protein
Lus10033693
[exp]
58 / 5e-13 AT4G28290 62 / 3e-14 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G111501
[exp]
52 / 1e-10 AT4G28290 49 / 3e-09 unknown protein
Potri.019G100601
[exp]
52 / 1e-10 AT4G28290 49 / 3e-09 unknown protein
Potri.013G131900
[exp]
50 / 8e-10 AT4G28290 47 / 7e-09 unknown protein
Potri.001G449633
[exp]
49 / 2e-09 AT4G28290 45 / 7e-08 unknown protein
Potri.011G151900
[exp]
42 / 9e-07 AT5G42110 38 / 3e-05 unknown protein
PFAM info
Representative CDS sequence
>Lus10018592 pacid=23180365 polypeptide=Lus10018592 locus=Lus10018592.g ID=Lus10018592.BGIv1.0 annot-version=v1.0
ATGAAGATACCAAGCTTTATCGCCGCCTCCGTCGCCGCCGCAGCGGCGTCTGCAACCGCCATCTCCGCTTCTTCATCATCTTCAAGTCGCCAGGAGGGTG
GTTTGAGCAACGATGAGAGACAGATCAGGCCGGCGGAGAAGTTTGCGCCGAGGTTCGATGGGCTTAGGTTTATCGAGACGTTGGTCACAGCTCATCGGTG
A
AA sequence
>Lus10018592 pacid=23180365 polypeptide=Lus10018592 locus=Lus10018592.g ID=Lus10018592.BGIv1.0 annot-version=v1.0
MKIPSFIAASVAAAAASATAISASSSSSSRQEGGLSNDERQIRPAEKFAPRFDGLRFIETLVTAHR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28290 unknown protein Lus10018592
[exp]
0 1
AT4G37850 bHLH bHLH025 basic helix-loop-helix (bHLH) ... Lus10011578
[exp]
2.8 0.8441
AT3G09830 Protein kinase superfamily pro... Lus10038711
[exp]
2.8 0.8519
AT2G41430 LSR1, CID1, ERD... CTC-Interacting Domain 1, dehy... Lus10031029
[exp]
3.0 0.8619
AT2G22760 bHLH bHLH019 basic helix-loop-helix (bHLH) ... Lus10006085
[exp]
3.9 0.8349
AT4G21390 B120 S-locus lectin protein kinase ... Lus10018408
[exp]
5.3 0.8306
AT1G53050 Protein kinase superfamily pro... Lus10033684
[exp]
5.7 0.8505
AT2G33150 PED1, KAT2, PKT... PEROXISOME DEFECTIVE 1, 3-KETO... Lus10011879
[exp]
10.6 0.8091
AT1G64610 Transducin/WD40 repeat-like su... Lus10017312
[exp]
11.7 0.8254
AT2G32260 ATCCT1 phosphorylcholine cytidylyltra... Lus10027337
[exp]
12.7 0.8345
AT1G14860 ATNUDT18 nudix hydrolase homolog 18 (.1... Lus10034598
[exp]
14.4 0.8096

Lus10018592 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.