Lus10018595 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G70890 56 / 2e-10 MLP43 MLP-like protein 43 (.1)
AT1G23120 54 / 8e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70830 51 / 2e-08 MLP28 MLP-like protein 28 (.1.2.3.4.5)
AT1G70880 49 / 6e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G28000 49 / 2e-07 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70870 44 / 5e-06 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039830 296 / 6e-105 AT1G24020 62 / 1e-12 MLP-like protein 423 (.1.2)
Lus10030840 64 / 4e-13 AT1G24020 189 / 2e-62 MLP-like protein 423 (.1.2)
Lus10030646 63 / 6e-13 AT1G24020 189 / 3e-62 MLP-like protein 423 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G131000 213 / 7e-72 AT1G24020 62 / 1e-12 MLP-like protein 423 (.1.2)
Potri.010G096000 59 / 9e-12 AT1G24020 188 / 3e-62 MLP-like protein 423 (.1.2)
Potri.001G405600 55 / 6e-10 ND /
Potri.011G127800 54 / 1e-09 ND /
Potri.004G033000 44 / 5e-06 AT1G24020 57 / 1e-10 MLP-like protein 423 (.1.2)
Potri.004G032900 43 / 2e-05 AT1G24020 59 / 2e-11 MLP-like protein 423 (.1.2)
Potri.010G000600 40 / 0.0002 AT1G24020 67 / 1e-14 MLP-like protein 423 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Lus10018595 pacid=23180390 polypeptide=Lus10018595 locus=Lus10018595.g ID=Lus10018595.BGIv1.0 annot-version=v1.0
ATGAAGAGCATGAAAGGAGAAGTGGAGTTGGAGATGGAGGCAGAGAGAGCATGGAGGATGTACATAGACAACGACACCGTCAGCAAAATCAACCCTCAAA
TGCTTTCACTGGCCAAGTATTTGGAAGGAGATGGCAGCCCTGGTAGCATCAGACTCTTCCAGCTTGGCCCTGCTGTGCAAAGCTACGTGAAGGAATCGAC
GCAGAAGATCGAACAAATCGAGACCAGCCGGTCAATAACCTACACAGTCATCGCCGGCGACCTCAGCAACATGTACAATCCTTACAGGGTCACCTTCTCC
TTCCTCCCTTCCGACAACCACAAAAAATGCATTGCTCAATGGCAGGCCGAGTTCAAGCCAATTTCTGAGTTGACCCCTCTGCCGGAGCAGGCCAGAGACA
CTGCGCTCACCTTCCTCAAGTCGTTCGATAAGTTCGAGCGATCGCCTAATTCTGCATAA
AA sequence
>Lus10018595 pacid=23180390 polypeptide=Lus10018595 locus=Lus10018595.g ID=Lus10018595.BGIv1.0 annot-version=v1.0
MKSMKGEVELEMEAERAWRMYIDNDTVSKINPQMLSLAKYLEGDGSPGSIRLFQLGPAVQSYVKESTQKIEQIETSRSITYTVIAGDLSNMYNPYRVTFS
FLPSDNHKKCIAQWQAEFKPISELTPLPEQARDTALTFLKSFDKFERSPNSA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10018595 0 1
AT1G73390 Endosomal targeting BRO1-like ... Lus10042289 2.4 0.8325
AT1G28220 ATPUP3 purine permease 3 (.1) Lus10020950 2.6 0.7942
AT5G04830 Nuclear transport factor 2 (NT... Lus10028847 4.0 0.7814
AT4G21120 CAT1, AAT1 CATIONIC AMINO ACID TRANSPORTE... Lus10001581 4.2 0.8151
AT3G27030 unknown protein Lus10041550 4.5 0.8117
AT1G17950 MYB AtMYB52, BW52, ... myb domain protein 52 (.1) Lus10029746 5.7 0.8156
AT4G16780 HD ATHB2, HAT4, AT... ARABIDOPSIS THALIANA HOMEOBOX ... Lus10007849 6.9 0.7960
AT2G39510 nodulin MtN21 /EamA-like trans... Lus10023432 10.9 0.7595
AT5G38710 Methylenetetrahydrofolate redu... Lus10034095 11.2 0.7982
AT5G41590 Protein of unknown function (D... Lus10028756 13.0 0.7349

Lus10018595 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.