Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22630 107 / 2e-31 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039849 [exp] 65 / 5e-14 AT1G02550 46 / 3e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G108100 [exp] 104 / 3e-30 AT1G22630 102 / 3e-29 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018614 pacid=23180448 polypeptide=Lus10018614 locus=Lus10018614.g ID=Lus10018614.BGIv1.0 annot-version=v1.0 ATGATTTCCATTTCAGCAGCATCATCATCAGGGTTCGTCTTCACTGGAGATCAAGTAAAGTATAATAAACCATCAAGAACTGATCTAGTGAAGGTTTCTG CAGCCAAATCTGGAGGATTCTCTTTCAACTCTATTCTGGGGAAGAAGTGTGGAACCTGTGGAGGCAAAAGTGCCATCGAGTGTCCCGGATGCAAGGGGAC GGGGAAGAACAAGAAGAATGGTAACATGTTTGAGCGGTGGAAGTGTTTTGATTGCCAAGGGTTTGGGATGAAGAGCTGCCCAAGCTGTGGAGAAGGAGGG CTGACACCTGAGCAGAGGGGAGAAAGATGA
AA sequence Show only first row Show all	>Lus10018614 pacid=23180448 polypeptide=Lus10018614 locus=Lus10018614.g ID=Lus10018614.BGIv1.0 annot-version=v1.0 MISISAASSSGFVFTGDQVKYNKPSRTDLVKVSAAKSGGFSFNSILGKKCGTCGGKSAIECPGCKGTGKNKKNGNMFERWKCFDCQGFGMKSCPSCGEGG LTPEQRGER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G22630			unknown protein		Lus10018614 [exp]	0	1
AT4G12800		PSAL	photosystem I subunit l (.1)		Lus10002143 [exp]	3.6	0.9688
AT3G10405			unknown protein		Lus10037959 [exp]	4.5	0.9555
					Lus10023773 [exp]	5.5	0.9447
AT1G52230		PSAH2, PSAH-2, ...	PHOTOSYSTEM I SUBUNIT H-2, pho...		Lus10025798 [exp]	6.6	0.9622
AT1G18170			FKBP-like peptidyl-prolyl cis-...		Lus10038954 [exp]	6.9	0.9613
AT1G30380		PSAK	photosystem I subunit K (.1)		Lus10007399 [exp]	7.7	0.9582
AT1G69550			disease resistance protein (TI...		Lus10001788 [exp]	8.7	0.9229
AT1G72610		ATGER1, GLP1	A. THALIANA GERMIN-LIKE PROTEI...		Lus10002795 [exp]	10.2	0.9479
AT1G27385			unknown protein		Lus10037024 [exp]	10.6	0.9325
AT1G30380		PSAK	photosystem I subunit K (.1)		Lus10012086 [exp]	12.2	0.9554

Compare expression of checked genes

Lus10018614 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.