Lus10018615 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02550 42 / 4e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039849 184 / 6e-60 AT1G02550 46 / 3e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038294 42 / 9e-05 ND 42 / 4e-04
Lus10025807 42 / 0.0001 ND 39 / 0.002
Lus10025806 42 / 0.0001 ND 40 / 0.002
Lus10038295 41 / 0.0002 ND 37 / 0.005
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G119200 50 / 9e-08 AT1G02550 97 / 2e-24 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.014G119400 49 / 3e-07 AT1G02550 78 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G194800 46 / 3e-06 AT1G02550 87 / 2e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G194900 43 / 2e-05 AT1G02550 87 / 2e-20 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10018615 pacid=23180509 polypeptide=Lus10018615 locus=Lus10018615.g ID=Lus10018615.BGIv1.0 annot-version=v1.0
ATGACGAAAAAGGGCGTCTTGGGGAGCGAAATCAACCCGGCCCTCCGCGAGATCTGCCTGGCCACCAAGACGCCGAACAAATGCTCCGACTACCTCGCTC
CGATCGCCGTCGGCGCCGGCGGCACGTACCAGGACCCCGTGTCGATCCTCAACCTGGAGATCGAGCTCCTCTACAAGAAGGTGGAGAAGGCCGCCGAAGA
GGCGGGGGAGATCGGGAAAAAGGGGTCCACCCCTGCTGATGTGGCGAAGGCGCTGACGTCTTGCGTGGAGGATTACAACAAGGCGAAGGATGACCTGGCG
ATGGCTCTGTTGCAGTTTTCCGAGAAGAAGGACGCTGCCAGCGTGGATGGGAGTCTGACGTCGGCTGCCACGTGGGTTAAGAAATGCGACGCTGGGTTTA
ATGGGAAGGGGGAGGAGAAGATGGAGAAGATGAATGTGAAGATTGTTGAGATGGCGGAGTTGGGGATTGAGATTTCCGATAAGTGGCTTAAGAAAGCTAA
TTAA
AA sequence
>Lus10018615 pacid=23180509 polypeptide=Lus10018615 locus=Lus10018615.g ID=Lus10018615.BGIv1.0 annot-version=v1.0
MTKKGVLGSEINPALREICLATKTPNKCSDYLAPIAVGAGGTYQDPVSILNLEIELLYKKVEKAAEEAGEIGKKGSTPADVAKALTSCVEDYNKAKDDLA
MALLQFSEKKDAASVDGSLTSAATWVKKCDAGFNGKGEEKMEKMNVKIVEMAELGIEISDKWLKKAN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G02550 Plant invertase/pectin methyle... Lus10018615 0 1
AT1G32220 NAD(P)-binding Rossmann-fold s... Lus10010419 8.0 0.8306
AT3G54890 LHCA1 photosystem I light harvesting... Lus10023509 21.0 0.8187
AT3G08870 Concanavalin A-like lectin pro... Lus10012509 21.4 0.7663
AT4G31530 NAD(P)-binding Rossmann-fold s... Lus10022420 31.2 0.8077
AT3G54890 LHCA1 photosystem I light harvesting... Lus10040391 32.9 0.8007
AT4G03230 S-locus lectin protein kinase ... Lus10031591 33.2 0.7785
AT4G18210 ATPUP10 purine permease 10 (.1) Lus10023317 36.7 0.7457
AT4G19170 CCD4, NCED4 carotenoid cleavage dioxygenas... Lus10035696 41.6 0.7935
AT4G18210 ATPUP10 purine permease 10 (.1) Lus10023318 41.9 0.7501
AT1G68660 Ribosomal protein L12/ ATP-dep... Lus10034292 42.1 0.7800

Lus10018615 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.