Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039856 [exp] 87 / 7e-24 ND / Lus10010798 [exp] 72 / 4e-16 AT5G27260 61 / 5e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G138100 [exp] 66 / 2e-14 AT5G44210 149 / 3e-45 ERF DOMAIN PROTEIN- 9, erf domain protein 9 (.1) Potri.017G013700 [exp] 44 / 4e-06 AT5G44210 103 / 2e-27 ERF DOMAIN PROTEIN- 9, erf domain protein 9 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018622 pacid=23180372 polypeptide=Lus10018622 locus=Lus10018622.g ID=Lus10018622.BGIv1.0 annot-version=v1.0 ATGGTTGGTAGGTTTCCGTTTGTGTACCAGCAGCAGCAGCCGCAGGGGATAATGACTCCGGTGTGGTTCTTCGACGGGATGGTGAAGCCTGAGTTCGTGA CAGCTCAGCGGTTCCCGGTCCGATTCGACCCGGTGGATTACAACGGTGGAAGAGCGTTCCGACCTCGTCTCCGCCGGTGGAGGCCTTATCGCCGGCCGTT CATTTCCCGAAAAAATAACTTTTTTTTAATCGGGTTGGAGAGATCACAGGAAGAAGAAAATTACATTAAGTACATGATCGACGAAGGAGATCTGGAAATT CAAAGGGTTAATTAA
AA sequence Show only first row Show all	>Lus10018622 pacid=23180372 polypeptide=Lus10018622 locus=Lus10018622.g ID=Lus10018622.BGIv1.0 annot-version=v1.0 MVGRFPFVYQQQQPQGIMTPVWFFDGMVKPEFVTAQRFPVRFDPVDYNGGRAFRPRLRRWRPYRRPFISRKNNFFLIGLERSQEEENYIKYMIDEGDLEI QRVN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018622 [exp]	0	1
					Lus10039856 [exp]	1.4	0.9082
AT5G17350			unknown protein		Lus10034636 [exp]	2.0	0.9095
AT1G72460			Leucine-rich repeat protein ki...		Lus10027645 [exp]	3.2	0.8628
AT5G42570			B-cell receptor-associated 31-...		Lus10035283 [exp]	4.0	0.8661
AT1G08250		AtADT6, ADT6	Arabidopsis thaliana arogenate...		Lus10019526 [exp]	5.2	0.9029
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10012224 [exp]	5.5	0.8764
AT1G29340		ATPUB17, PUB17	ARABIDOPSIS THALIANA PLANT U-B...		Lus10029267 [exp]	6.9	0.8508
AT2G25250			unknown protein		Lus10041025 [exp]	7.2	0.8880
AT1G08250		AtADT6, ADT6	Arabidopsis thaliana arogenate...		Lus10043369 [exp]	7.4	0.8777
AT4G14450		ATBET12	unknown protein		Lus10021208 [exp]	9.4	0.8613

Compare expression of checked genes

Lus10018622 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.