Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039863 [exp] 138 / 1e-43 AT5G28010 42 / 3e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10039864 [exp] 125 / 5e-37 AT5G54160 65 / 7e-12 O-methyltransferase 1 (.1) Lus10002175 [exp] 104 / 3e-30 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10039891 [exp] 96 / 8e-27 AT5G28010 59 / 3e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10002174 [exp] 96 / 1e-26 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10002176 [exp] 58 / 7e-12 AT1G24020 65 / 7e-14 MLP-like protein 423 (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018627 pacid=23180446 polypeptide=Lus10018627 locus=Lus10018627.g ID=Lus10018627.BGIv1.0 annot-version=v1.0 ATGGCGGCTCAGATTCACAAGCTCGAGGCTAAGTTTGCAATGAAATCACCTGAGAAGCTGGTGGGTTTCTTCAGGGACCATGTCCACGACCTGCCGAAAC TGGCTCCTGCTATGGTCAAGACCTCTGAAGTTGTTGGAAAAGGGCTCAGAATGGGTCATGGCTCTGTCTTTCACGTGATTTACTCCCTCCCTGGAGTTCC GAGCTTCGTGAGTGTGAAGATAAAGGTGGAAGAAATGGAGGAAGAAGCTGCCGGAAGCAAGTCGATGAGATAG
AA sequence Show only first row Show all	>Lus10018627 pacid=23180446 polypeptide=Lus10018627 locus=Lus10018627.g ID=Lus10018627.BGIv1.0 annot-version=v1.0 MAAQIHKLEAKFAMKSPEKLVGFFRDHVHDLPKLAPAMVKTSEVVGKGLRMGHGSVFHVIYSLPGVPSFVSVKIKVEEMEEEAAGSKSMR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018627 [exp]	0	1
					Lus10000650 [exp]	1.0	0.9446
					Lus10041944 [exp]	3.5	0.9090
AT2G43610			Chitinase family protein (.1)		Lus10003586 [exp]	4.2	0.9026
					Lus10031014 [exp]	9.8	0.8928
AT3G02850		SKOR	STELAR K+ outward rectifier, S...		Lus10035498 [exp]	10.0	0.8967
AT1G35670		CPK11, ATCDPK2,...	calcium-dependent protein kina...		Lus10014820 [exp]	12.0	0.8786
AT2G30540			Thioredoxin superfamily protei...		Lus10040899 [exp]	12.6	0.9022
AT5G05365			Heavy metal transport/detoxifi...		Lus10009848 [exp]	15.0	0.8766
AT5G41850			alpha/beta-Hydrolases superfam...		Lus10032373 [exp]	15.0	0.8755
AT3G07880		SCN1	SUPERCENTIPEDE1, Immunoglobuli...		Lus10010491 [exp]	15.7	0.8602

Compare expression of checked genes

Lus10018627 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.