Lus10018631 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28480 128 / 6e-39 roxy19, GRX480 Thioredoxin superfamily protein (.1)
AT1G03850 109 / 1e-31 ATGRXS13 glutaredoxin 13, Glutaredoxin family protein (.1.2)
AT4G15700 96 / 8e-27 Thioredoxin superfamily protein (.1)
AT4G15660 95 / 3e-26 Thioredoxin superfamily protein (.1)
AT4G15690 94 / 4e-26 Thioredoxin superfamily protein (.1)
AT4G15670 94 / 7e-26 Thioredoxin superfamily protein (.1)
AT4G15680 93 / 1e-25 Thioredoxin superfamily protein (.1)
AT5G18600 92 / 3e-25 Thioredoxin superfamily protein (.1)
AT5G14070 91 / 4e-24 ROXY2 Thioredoxin superfamily protein (.1)
AT4G33040 87 / 1e-22 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039867 245 / 3e-85 AT1G28480 127 / 7e-39 Thioredoxin superfamily protein (.1)
Lus10013962 134 / 1e-41 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1)
Lus10017693 121 / 7e-37 AT1G28480 100 / 4e-29 Thioredoxin superfamily protein (.1)
Lus10033649 119 / 5e-36 AT1G28480 100 / 5e-29 Thioredoxin superfamily protein (.1)
Lus10041538 107 / 7e-31 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1)
Lus10035183 97 / 9e-27 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
Lus10011333 97 / 1e-26 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1)
Lus10038514 92 / 2e-24 AT5G14070 122 / 2e-36 Thioredoxin superfamily protein (.1)
Lus10023295 90 / 7e-24 AT5G14070 123 / 5e-37 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G134800 158 / 1e-50 AT1G28480 141 / 9e-44 Thioredoxin superfamily protein (.1)
Potri.017G017300 157 / 2e-50 AT1G28480 132 / 3e-40 Thioredoxin superfamily protein (.1)
Potri.004G049800 140 / 1e-43 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1)
Potri.011G058800 128 / 5e-39 AT1G28480 102 / 2e-28 Thioredoxin superfamily protein (.1)
Potri.001G325800 102 / 5e-29 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1)
Potri.003G167000 100 / 2e-28 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1)
Potri.001G060600 100 / 3e-28 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
Potri.010G021800 86 / 8e-23 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1)
Potri.008G214500 86 / 1e-22 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1)
Potri.002G209300 83 / 1e-21 AT1G03020 143 / 7e-46 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Lus10018631 pacid=23180406 polypeptide=Lus10018631 locus=Lus10018631.g ID=Lus10018631.BGIv1.0 annot-version=v1.0
ATGCAGGAGGCGATTCCGTACAAGTCATGGCAACCGCAATATACAAAGCAGCCGTTTTTAACCAAAGGCGGCGACATCCTCCCAGCCACGGCGGCGCCGG
CGGAGGTTGTGTCAGAGAATGCCATAGTAGTCTTCGCCAGGAGAGGCTGCTGCATGACCCACGTCGTCAAGCGGCTGCTCCTCTGTTTAGGGGTCAACCC
GCCGGTGTTCGAGGTGGACGAGGGCGACGAGGGTTGGGTTTTGAAGGATTTGAAGTTGCCGGCTACGGTCGGAATGCAGTTTCCGGCGGTTTTTATCGGT
GGAGAGTTGTTTGGTGGGTTGGATAAGGTCATGGCGAGTCATATCGCCGGCGAGTTGGTTCCTGTTCTTAAACAAGCTGGAGCCTTGTGGCTTTGA
AA sequence
>Lus10018631 pacid=23180406 polypeptide=Lus10018631 locus=Lus10018631.g ID=Lus10018631.BGIv1.0 annot-version=v1.0
MQEAIPYKSWQPQYTKQPFLTKGGDILPATAAPAEVVSENAIVVFARRGCCMTHVVKRLLLCLGVNPPVFEVDEGDEGWVLKDLKLPATVGMQFPAVFIG
GELFGGLDKVMASHIAGELVPVLKQAGALWL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G28480 roxy19, GRX480 Thioredoxin superfamily protei... Lus10018631 0 1
AT2G48010 RKF3 receptor-like kinase in in flo... Lus10008187 3.5 0.9402
AT3G11820 PEN1, AT-SYR1, ... PENETRATION1, SYNTAXIN RELATED... Lus10013589 6.7 0.9259
AT1G09155 ATPP2-B15 phloem protein 2-B15 (.1) Lus10031473 9.5 0.9136
AT1G58420 Uncharacterised conserved prot... Lus10012496 9.9 0.9315
AT4G27270 Quinone reductase family prote... Lus10006748 11.0 0.8886
AT4G34150 Calcium-dependent lipid-bindin... Lus10014088 11.0 0.9222
AT3G18950 Transducin/WD40 repeat-like su... Lus10012036 15.8 0.8883
AT4G12070 unknown protein Lus10031828 16.0 0.8841
AT1G76650 CML38 calmodulin-like 38 (.1.2.3) Lus10022343 16.2 0.8891
AT4G31550 WRKY ATWRKY11, WRKY1... WRKY DNA-binding protein 11 (.... Lus10020136 16.4 0.9225

Lus10018631 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.