Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042963 [exp] 71 / 4e-17 ND / Lus10039880 [exp] 64 / 3e-13 AT1G28490 271 / 4e-91 syntaxin of plants 61 (.1.2) Lus10029845 [exp] 56 / 6e-11 AT4G38080 40 / 6e-05 hydroxyproline-rich glycoprotein family protein (.1) Lus10018645 [exp] 37 / 0.0004 ND 35 / 0.004
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G082733 [exp] 39 / 8e-05 ND / Potri.017G045501 [exp] 38 / 0.0004 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018643 pacid=23180423 polypeptide=Lus10018643 locus=Lus10018643.g ID=Lus10018643.BGIv1.0 annot-version=v1.0 ATGGCATCTTCCAAGTCCTTCTGCTTCCTCTTTGCCATCTGCTTCGCCGTCTCATTCTCCAACATGGATGCTACAATGGCGGCTCGCCAGCTCCTCCAAG CCCCAACTCTGCCACAGCCGACTCTGCCTCAGCCGACTCTGCCGATGCCAACTCTGCCTACCACCGGACTGCCGCCAATCCCAGCCGCCGGCGCCATTCC GGCGATTCCTGTCTCCATCCCGAAGGTTACACTGCCGCCATTGCCTGCCAACTTCCCGAAGATCCCTTCGATTCCGTTCACCATGCCTTCTATCCCTGGC CTCTTTGCACCACCTCCTAGCAACTAG
AA sequence Show only first row Show all	>Lus10018643 pacid=23180423 polypeptide=Lus10018643 locus=Lus10018643.g ID=Lus10018643.BGIv1.0 annot-version=v1.0 MASSKSFCFLFAICFAVSFSNMDATMAARQLLQAPTLPQPTLPQPTLPMPTLPTTGLPPIPAAGAIPAIPVSIPKVTLPPLPANFPKIPSIPFTMPSIPG LFAPPPSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018643 [exp]	0	1
AT1G28490		OSM1, ATSYP61, ...	syntaxin of plants 61 (.1.2)		Lus10039880 [exp]	1.0	0.9796
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10032554 [exp]	2.8	0.9763
AT5G07475			Cupredoxin superfamily protein...		Lus10012085 [exp]	3.0	0.9759
					Lus10033359 [exp]	4.5	0.9651
AT5G09520		PELPK2	Pro-Glu-Leu|Ile|Val-Pro-Lys 2,...		Lus10034813 [exp]	5.5	0.9615
AT1G29000			Heavy metal transport/detoxifi...		Lus10011893 [exp]	6.0	0.9553
AT1G64000	WRKY	ATWRKY56, WRKY5...	WRKY DNA-binding protein 56 (....		Lus10007906 [exp]	6.9	0.9595
AT4G24130			Protein of unknown function, D...		Lus10017330 [exp]	7.4	0.9627
					Lus10034812 [exp]	7.9	0.9604
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10020481 [exp]	8.4	0.9278

Compare expression of checked genes

Lus10018643 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.