Lus10018645 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10018645 pacid=23180514 polypeptide=Lus10018645 locus=Lus10018645.g ID=Lus10018645.BGIv1.0 annot-version=v1.0
ATGGCATCATCATCTTCCAAGTCGTTGTGCTTTTTCTTACTAGCTATCTTCGTTGCTGTTTCATTCTCCAACATGGAACCAACAATGGCTAGTACGCGCA
AGCTCCTCCAGCTTCCCAACATCCCCAATTTGCCCTCATTGCCTCCTATGCCTATTAGTACAATTCCAACTCTGCCCCTGCCGACTCTGCCTTCCGGGTT
GCCACCACTCGCGGCAGCAGGAGCGATGCCGGCGATTCCACAGCTTCCTTCCATCCCAAAGGTGTCTCTGCCCCCGCTGCCTAGCAACATCCCGAGTATT
CCCATCAATATCCCTGGCTTCGCAGCGCCGCCTCCTAGCAACTAA
AA sequence
>Lus10018645 pacid=23180514 polypeptide=Lus10018645 locus=Lus10018645.g ID=Lus10018645.BGIv1.0 annot-version=v1.0
MASSSSKSLCFFLLAIFVAVSFSNMEPTMASTRKLLQLPNIPNLPSLPPMPISTIPTLPLPTLPSGLPPLAAAGAMPAIPQLPSIPKVSLPPLPSNIPSI
PINIPGFAAPPPSN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10018645 0 1
AT1G11040 HSP40/DnaJ peptide-binding pro... Lus10018152 1.0 0.7745
AT3G45850 P-loop containing nucleoside t... Lus10025275 2.0 0.7518
AT1G75820 ATCLV1, FLO5, F... FLOWER DEVELOPMENT 5, FASCIATA... Lus10040592 5.2 0.7498
AT3G18830 ATPMT5, AtPLT5 ARABIDOPSIS THALIANA POLYOL/MO... Lus10026328 7.4 0.7371
AT3G18830 ATPMT5, AtPLT5 ARABIDOPSIS THALIANA POLYOL/MO... Lus10042339 9.2 0.7349
AT4G08300 nodulin MtN21 /EamA-like trans... Lus10022187 12.8 0.7224
AT5G20270 HHP1 heptahelical transmembrane pro... Lus10038120 15.5 0.7297
AT4G06536 SPla/RYanodine receptor (SPRY)... Lus10010241 20.5 0.7077
Lus10000292 21.0 0.6182
AT1G04220 KCS2 3-ketoacyl-CoA synthase 2 (.1) Lus10039401 28.9 0.7187

Lus10018645 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.