Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10130 107 / 7e-29 ATECA3, ECA3 ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 3, endoplasmic reticulum-type calcium-transporting ATPase 3 (.1) AT1G07670 68 / 4e-15 ATECA4 endomembrane-type CA-ATPase 4 (.1) AT1G07810 65 / 5e-14 ATECA1, ACA3, ECA1 ER-type Ca2+-ATPase 1, ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 1, ER-type Ca2+-ATPase 1 (.1) AT4G00900 63 / 2e-13 ATECA2, ECA2 ER-type Ca2+-ATPase 2, ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 2, ER-type Ca2+-ATPase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007734 [exp] 97 / 4e-25 AT1G10130 1639 / 0.0 ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 3, endoplasmic reticulum-type calcium-transporting ATPase 3 (.1) Lus10038484 [exp] 66 / 5e-14 AT1G07670 816 / 0.0 endomembrane-type CA-ATPase 4 (.1) Lus10023328 [exp] 65 / 9e-14 AT1G07670 1549 / 0.0 endomembrane-type CA-ATPase 4 (.1) Lus10028139 [exp] 64 / 1e-13 AT1G07670 1798 / 0.0 endomembrane-type CA-ATPase 4 (.1) Lus10042843 [exp] 64 / 1e-13 AT1G07670 1799 / 0.0 endomembrane-type CA-ATPase 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G014700 [exp] 93 / 6e-24 AT1G10130 1659 / 0.0 ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 3, endoplasmic reticulum-type calcium-transporting ATPase 3 (.1) Potri.002G117400 [exp] 92 / 1e-23 AT1G10130 1648 / 0.0 ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 3, endoplasmic reticulum-type calcium-transporting ATPase 3 (.1) Potri.009G025700 [exp] 63 / 3e-13 AT1G07670 1743 / 0.0 endomembrane-type CA-ATPase 4 (.1) Potri.014G101900 [exp] 60 / 3e-12 AT4G00900 1698 / 0.0 ER-type Ca2+-ATPase 2, ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 2, ER-type Ca2+-ATPase 2 (.1) Potri.001G233400 [exp] 57 / 2e-11 AT1G07670 1800 / 0.0 endomembrane-type CA-ATPase 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00690 [flax] [poplar] Cation_ATPase_N Cation transporter/ATPase, N-terminus
Representative CDS sequence Show only first row Show all	>Lus10018669 pacid=23176269 polypeptide=Lus10018669 locus=Lus10018669.g ID=Lus10018669.BGIv1.0 annot-version=v1.0 ATGGAGGATGCCTATGCTAGATCCGTCACTGAGGTTTTACTGCATGCCAAAATGTTCGGCAAGAATGGAACTCCTTTCTGGAAATTGGTTCTGAAACAGT TCGATGATTTGCTTGTTAAAATACTGATAGCTGCTGCGATTGTGTCTTTCATTTTGGCTTTGATTAACGGGGAAACTGGCCTGACTGCCTTTGTGGAGCC TTTTGTAAGATATCTTTTTGTTTGGTCAAACTAA
AA sequence Show only first row Show all	>Lus10018669 pacid=23176269 polypeptide=Lus10018669 locus=Lus10018669.g ID=Lus10018669.BGIv1.0 annot-version=v1.0 MEDAYARSVTEVLLHAKMFGKNGTPFWKLVLKQFDDLLVKILIAAAIVSFILALINGETGLTAFVEPFVRYLFVWSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G10130		ATECA3, ECA3	ARABIDOPSIS THALIANA ER-TYPE C...		Lus10018669 [exp]	0	1
AT2G45540			WD-40 repeat family protein / ...		Lus10009307 [exp]	10.5	0.8913
AT3G60920			unknown protein		Lus10009306 [exp]	17.0	0.8760
AT1G03060		SPI	SPIRRIG, Beige/BEACH domain ;W...		Lus10024828 [exp]	19.8	0.8733
AT4G31570			unknown protein		Lus10020133 [exp]	22.1	0.8720
					Lus10042684 [exp]	22.2	0.7689
AT2G35630		GEM1, MOR1	MICROTUBULE ORGANIZATION 1, AR...		Lus10001216 [exp]	28.8	0.8734
AT2G45540			WD-40 repeat family protein / ...		Lus10015857 [exp]	33.3	0.8675
AT2G15900			Phox-associated domain;Phox-li...		Lus10012043 [exp]	37.2	0.8537
AT3G14470			NB-ARC domain-containing disea...		Lus10002736 [exp]	38.3	0.8579
AT2G01820		CYCJ18	Leucine-rich repeat protein ki...		Lus10013342 [exp]	38.5	0.8472

Compare expression of checked genes

Lus10018669 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.