Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036646 [exp] 45 / 1e-06 ND 37 / 0.010
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018670 pacid=23176250 polypeptide=Lus10018670 locus=Lus10018670.g ID=Lus10018670.BGIv1.0 annot-version=v1.0 ATGGACCATGTTACGGTTTCAACCACAAACAAACGGTCATGGGTGGTAGCTAACACCTTTCTCAATCTGAAGAAGTGGGATGGATGCGGTGAGCCTAAAA ACCATCCATTCCAAATCGTCGACATGTGGATCCACATCCACAAGCTACCACCAACATACAAATCATTGGAGAACATCAAGGTGAATGGAAACCTTTTTTC CGTTACCACAAATGCGACCAAGCATGCCTTGAAAGTGGGATATGAAGACGCTACATCCGAGCCTTCGTAG
AA sequence Show only first row Show all	>Lus10018670 pacid=23176250 polypeptide=Lus10018670 locus=Lus10018670.g ID=Lus10018670.BGIv1.0 annot-version=v1.0 MDHVTVSTTNKRSWVVANTFLNLKKWDGCGEPKNHPFQIVDMWIHIHKLPPTYKSLENIKVNGNLFSVTTNATKHALKVGYEDATSEPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10018670 [exp]	0	1
AT3G27890		NQR	NADPH:quinone oxidoreductase (...		Lus10026172 [exp]	3.5	0.9000
					Lus10008051 [exp]	8.9	0.9201
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10039830 [exp]	10.2	0.9155
AT5G42610			Protein of unknown function (D...		Lus10010793 [exp]	14.0	0.9047
AT3G19990			unknown protein		Lus10038848 [exp]	18.6	0.8990
					Lus10004450 [exp]	19.0	0.8820
AT1G05680		UGT74E2	Uridine diphosphate glycosyltr...		Lus10029197 [exp]	23.4	0.8400
AT4G29820		CFIM-25, ATCFIM...	ARABIDOPSIS THALIANA HOMOLOG O...		Lus10027624 [exp]	26.3	0.8969
AT5G49950			alpha/beta-Hydrolases superfam...		Lus10035807 [exp]	31.5	0.8531
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10025409 [exp]	32.0	0.8833

Compare expression of checked genes

Lus10018670 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.