Lus10018675 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G22370 469 / 5e-168 QQT1, EMB1705 QUATRE-QUART 1, EMBRYO DEFECTIVE 1705, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT4G12790 181 / 4e-55 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
AT4G21800 78 / 6e-16 QQT2 quatre-quart2, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007747 440 / 3e-157 AT5G22370 396 / 1e-140 QUATRE-QUART 1, EMBRYO DEFECTIVE 1705, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10041086 177 / 8e-54 AT4G12790 435 / 9e-156 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10036411 181 / 4e-53 AT4G12790 444 / 5e-156 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10040022 75 / 9e-15 AT4G21800 542 / 0.0 quatre-quart2, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Lus10019602 75 / 1e-14 AT4G21800 545 / 0.0 quatre-quart2, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G015700 508 / 0 AT5G22370 462 / 6e-166 QUATRE-QUART 1, EMBRYO DEFECTIVE 1705, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.014G174200 176 / 1e-53 AT4G12790 432 / 5e-155 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Potri.008G103000 78 / 6e-16 AT4G21800 527 / 0.0 quatre-quart2, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
Potri.010G148000 77 / 1e-15 AT4G21800 555 / 0.0 quatre-quart2, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF03029 ATP_bind_1 Conserved hypothetical ATP binding protein
Representative CDS sequence
>Lus10018675 pacid=23176274 polypeptide=Lus10018675 locus=Lus10018675.g ID=Lus10018675.BGIv1.0 annot-version=v1.0
ATGGTGTTTGGTCAAGTAGTGATCGGCCCTCCTGGTTCCGGCAAAACCACTTACTGCAATGGCATGTCTCAGTTCCTCCCTCTCATCGGCAGGAAAGTTG
CTGTCATCAATTTGGATCCCGCCAATGATTCCTTGCCTTACGATTGTGCCATAAATATCGAGGATCTCATCAAACTAAGTGATGTAATGGCAGAGCATTC
TCTCGGCCCAAACGGGGGTCTAGTTTACTGCATGGACTATTTGGAGAAGAACATTGACTGGTTGCAATCCAAGTTGCAACCTTTGTTGAAAGACCACTAT
CTTGTCTTTGATTTCCCTGGTCAGGTTGAACTGTTCTTCCTTCATTCAAATGCCAAGAACATTATTATGAAGCTTATCAAGAAGTTGAACCTTAGGTTGA
CTGCGGTACATTTAGTTGACGCACATCTCTGTAGTGATGCAAACAAGTATATTAGTGGATTGCTGCTATCATTGTCTACCATGATTCACATGGAACTCCC
GCACATCAATGTCTTGTCTAAGATCGATCTAATTGAGAGCTATGGAAAGTTGGCTTTCAACTTGGATTTCTACACGGACGTGCAAGACTTGTCATATTTG
CAGCATCATATTGAACAGGATCCTCGTGCAGCAAAGTACAGAAAACTTACAAAGGAGCTGTGCGAGGTTGTGGAAAATTACGGCCTCGTTAATTTCACAA
CTCTAGACATTCAGGCATGCCGAACACTTTTTGACAAAGAAAGTGTTGGAAATCTTGTGAAATTGATAGACAAGAGCAACGGTTACATCTTTGCTGGTAT
TGATGCCAGTGCTGTTGAATTCAGCAAGATTGCAGTGCGGGAAGTTGATTGGGATTATTACAGATATCCTTTTCTCATTCTCTACATTCGTATCACAGTT
GCAGCAGTGCAAGAGAAGTACATGAAAGATGAAGATGCATTCGATGACAGCGACAAGCCTGATATTTAG
AA sequence
>Lus10018675 pacid=23176274 polypeptide=Lus10018675 locus=Lus10018675.g ID=Lus10018675.BGIv1.0 annot-version=v1.0
MVFGQVVIGPPGSGKTTYCNGMSQFLPLIGRKVAVINLDPANDSLPYDCAINIEDLIKLSDVMAEHSLGPNGGLVYCMDYLEKNIDWLQSKLQPLLKDHY
LVFDFPGQVELFFLHSNAKNIIMKLIKKLNLRLTAVHLVDAHLCSDANKYISGLLLSLSTMIHMELPHINVLSKIDLIESYGKLAFNLDFYTDVQDLSYL
QHHIEQDPRAAKYRKLTKELCEVVENYGLVNFTTLDIQACRTLFDKESVGNLVKLIDKSNGYIFAGIDASAVEFSKIAVREVDWDYYRYPFLILYIRITV
AAVQEKYMKDEDAFDDSDKPDI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G22370 QQT1, EMB1705 QUATRE-QUART 1, EMBRYO DEFECTI... Lus10018675 0 1
AT4G39690 unknown protein Lus10016813 18.2 0.7595
AT3G61650 TUBG1 gamma-tubulin (.1) Lus10007851 21.5 0.7952
AT1G04945 HIT-type Zinc finger family pr... Lus10026116 25.6 0.7774
AT2G03670 CDC48B cell division cycle 48B (.1) Lus10018033 28.9 0.7909
AT5G06680 ATSPC98, SPC98,... ARABIDOPSIS THALIANA GAMMA TUB... Lus10029297 69.6 0.7655
AT3G52660 RNA-binding (RRM/RBD/RNP motif... Lus10034195 71.4 0.7658
AT5G62290 nucleotide-sensitive chloride ... Lus10038909 77.1 0.7649
AT3G56120 S-adenosyl-L-methionine-depend... Lus10017739 81.3 0.7611
AT5G14640 ATSK13 shaggy-like kinase 13 (.1) Lus10013088 85.7 0.7599
AT2G37050 Leucine-rich repeat protein ki... Lus10015057 97.6 0.7241

Lus10018675 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.