Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007744 [exp] 53 / 3e-10 AT5G63905 50 / 3e-09 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G015866 [exp] 44 / 5e-07 AT5G63905 44 / 1e-07 unknown protein Potri.002G118366 [exp] 41 / 7e-06 AT5G63905 40 / 5e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018677 pacid=23176225 polypeptide=Lus10018677 locus=Lus10018677.g ID=Lus10018677.BGIv1.0 annot-version=v1.0 ATGGGGATGTCGTGCTTTGCTTGTTTCGGCGGAGGAGACAAGCAACAGAGGGCGGAGGAAGCGCAGCGTGCCTCCGCCGAGGCTCGCGCTAAAGCTGCGG ATGCCGCTCAGAAAAGGCAAGAAGAATTCGAAAAATCTGCTGCTGGAAGGGCTGCACGTGCACAGTTACAGGGAATGGCTAAGCAATCTGCAAACCAAAA AAGAGGCGAACCAGTCCTCAAGAGAGCTCAGAGGGCTGAATATGTATATGGTATGTGGTCGAATGTTAAAGAAGAGCTCATTACGTGTACAAGTGAAACG ACCAGTTGGCAGAAGTTGTCACATTGA
AA sequence Show only first row Show all	>Lus10018677 pacid=23176225 polypeptide=Lus10018677 locus=Lus10018677.g ID=Lus10018677.BGIv1.0 annot-version=v1.0 MGMSCFACFGGGDKQQRAEEAQRASAEARAKAADAAQKRQEEFEKSAAGRAARAQLQGMAKQSANQKRGEPVLKRAQRAEYVYGMWSNVKEELITCTSET TSWQKLSH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G63905			unknown protein		Lus10018677 [exp]	0	1
AT5G14740		BETACA2, CA18, ...	CARBONIC ANHYDRASE 18, BETA CA...		Lus10030874 [exp]	1.4	0.8370
AT4G38060			unknown protein		Lus10032845 [exp]	4.7	0.8402
AT2G29960		CYP19-4, ATCYP5...	CYCLOPHILIN 19-4, ARABIDOPSIS ...		Lus10014846 [exp]	5.7	0.7778
AT1G76570			Chlorophyll A-B binding family...		Lus10015235 [exp]	8.5	0.8159
AT2G01110		TATC, PGA2, APG...	unfertilized embryo sac 3, TWI...		Lus10007945 [exp]	10.9	0.7630
AT2G27830			unknown protein		Lus10020544 [exp]	12.5	0.7563
AT4G11600		LSC803, PHGPX, ...	glutathione peroxidase 6 (.1)		Lus10000603 [exp]	13.6	0.7701
AT3G49870		ATARLA1C	ADP-ribosylation factor-like A...		Lus10025201 [exp]	17.5	0.7751
AT2G37975			Yos1-like protein (.1)		Lus10000226 [exp]	20.6	0.7590
AT4G29070			Phospholipase A2 family protei...		Lus10035314 [exp]	22.6	0.7619

Compare expression of checked genes

Lus10018677 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.