Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01400 73 / 2e-17 ARM repeat superfamily protein (.1) AT5G58680 57 / 1e-11 ARM repeat superfamily protein (.1) AT2G23140 54 / 2e-10 RING/U-box superfamily protein with ARM repeat domain (.1.2) AT3G54790 52 / 1e-09 ARM repeat superfamily protein (.1.2) AT4G16490 48 / 2e-08 ARM repeat superfamily protein (.1) AT5G67340 45 / 2e-07 ARM repeat superfamily protein (.1) AT1G71020 42 / 3e-06 ARM repeat superfamily protein (.1.2) AT1G23030 39 / 2e-05 PUB11 ARM repeat superfamily protein (.1) AT5G14510 35 / 0.0006 ARM repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007738 [exp] 100 / 1e-27 AT3G01400 555 / 0.0 ARM repeat superfamily protein (.1) Lus10017562 [exp] 52 / 7e-11 AT4G16490 149 / 3e-44 ARM repeat superfamily protein (.1) Lus10038811 [exp] 53 / 9e-11 AT4G16490 160 / 2e-48 ARM repeat superfamily protein (.1) Lus10039047 [exp] 53 / 5e-10 AT4G16490 549 / 0.0 ARM repeat superfamily protein (.1) Lus10010499 [exp] 52 / 6e-10 AT4G16490 608 / 0.0 ARM repeat superfamily protein (.1) Lus10011514 [exp] 52 / 7e-10 AT2G23140 916 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Lus10019308 [exp] 50 / 5e-09 AT2G23140 911 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Lus10024899 [exp] 49 / 1e-08 AT2G23140 551 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Lus10011516 [exp] 48 / 2e-08 AT2G23140 410 / 5e-134 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G118800 [exp] 84 / 1e-21 AT3G01400 521 / 0.0 ARM repeat superfamily protein (.1) Potri.014G016400 [exp] 77 / 8e-19 AT3G01400 557 / 0.0 ARM repeat superfamily protein (.1) Potri.005G144700 [exp] 57 / 1e-11 AT2G23140 972 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Potri.007G051000 [exp] 57 / 1e-11 AT2G23140 1018 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Potri.016G010800 [exp] 52 / 5e-10 AT4G16490 521 / 0.0 ARM repeat superfamily protein (.1) Potri.005G225400 [exp] 50 / 2e-09 AT3G54790 736 / 0.0 ARM repeat superfamily protein (.1.2) Potri.006G015100 [exp] 50 / 4e-09 AT4G16490 509 / 1e-178 ARM repeat superfamily protein (.1) Potri.002G037700 [exp] 50 / 5e-09 AT3G54790 707 / 0.0 ARM repeat superfamily protein (.1.2) Potri.001G344200 [exp] 41 / 7e-06 AT5G14510 310 / 5e-105 ARM repeat superfamily protein (.1) Potri.014G170100 [exp] 38 / 7e-05 AT4G12710 422 / 3e-147 ARM repeat superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018685 pacid=23176171 polypeptide=Lus10018685 locus=Lus10018685.g ID=Lus10018685.BGIv1.0 annot-version=v1.0 ATGGTGGCGCGTGAAGGAGCGATACCGCCGTTGGTTGCTCTGTCACAGTCCGGTACCAATCGCGCGAAGCAAAAGGCAGAGACACTGATAGAGCTGCTGA GGCAACCGAGATCCGGCAAGGGTGCTGGGAGGGCATCAGAGGTGTCGGTTTGA
AA sequence Show only first row Show all	>Lus10018685 pacid=23176171 polypeptide=Lus10018685 locus=Lus10018685.g ID=Lus10018685.BGIv1.0 annot-version=v1.0 MVAREGAIPPLVALSQSGTNRAKQKAETLIELLRQPRSGKGAGRASEVSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G01400			ARM repeat superfamily protein...		Lus10018685 [exp]	0	1
AT4G22240			Plastid-lipid associated prote...		Lus10014790 [exp]	2.2	0.8804
AT4G37680		HHP4	heptahelical protein 4 (.1.2)		Lus10025206 [exp]	2.4	0.8368
AT3G60520			unknown protein		Lus10028179 [exp]	4.5	0.8521
AT3G01400			ARM repeat superfamily protein...		Lus10018684 [exp]	5.7	0.8323
AT2G36320			A20/AN1-like zinc finger famil...		Lus10020594 [exp]	7.9	0.8238
AT2G26520			unknown protein		Lus10020993 [exp]	9.2	0.7930
AT1G68070			Zinc finger, C3HC4 type (RING ...		Lus10021801 [exp]	13.4	0.7955
AT3G48240			Octicosapeptide/Phox/Bem1p fam...		Lus10019490 [exp]	14.9	0.7995
AT1G32410			Vacuolar protein sorting 55 (V...		Lus10006605 [exp]	17.0	0.8304
AT2G27950			Ring/U-Box superfamily protein...		Lus10016162 [exp]	19.4	0.7780

Compare expression of checked genes

Lus10018685 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.