Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G01075 45 / 1e-07 Glycosyl hydrolase family 35 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007761 [exp] 65 / 8e-14 AT5G43140 223 / 1e-70 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G017600 [exp] 54 / 5e-11 AT5G01075 54 / 8e-11 Glycosyl hydrolase family 35 protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10018699 pacid=23176208 polypeptide=Lus10018699 locus=Lus10018699.g ID=Lus10018699.BGIv1.0 annot-version=v1.0 ATGATGGTGGTGGTGGCAGAGGCAGAAGCAGCAAGGAGCAGCAGAAAGCTCCTTCTTCTTCAGGAGGAGGAGGAGGAGGAGGAAAAGGCCGGAGGAGTAG AGGTGGTGGAAGATTACAGGCCAATAGATCCAGTGCCAAGCTCAAAGGCATCAGTGAAACCAGGTCCAATTGAACATGGCACTCCACTCAACCCTTTCAT CCCAAGATCCCCTCCTCCATCCAGTACCCCTCCCCCTTCACCCTTCTAA
AA sequence Show only first row Show all	>Lus10018699 pacid=23176208 polypeptide=Lus10018699 locus=Lus10018699.g ID=Lus10018699.BGIv1.0 annot-version=v1.0 MMVVVAEAEAARSSRKLLLLQEEEEEEEKAGGVEVVEDYRPIDPVPSSKASVKPGPIEHGTPLNPFIPRSPPPSSTPPPSPF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G01075			Glycosyl hydrolase family 35 p...		Lus10018699 [exp]	0	1
AT3G09860			unknown protein		Lus10001400 [exp]	3.0	0.8607
AT3G07640			unknown protein		Lus10041098 [exp]	6.3	0.7789
AT3G15790		MBD11, ATMBD11	methyl-CPG-binding domain 11 (...		Lus10043263 [exp]	7.5	0.8202
AT5G09250		KIWI	ssDNA-binding transcriptional ...		Lus10013733 [exp]	13.0	0.8058
AT1G29850			double-stranded DNA-binding fa...		Lus10004540 [exp]	13.3	0.8045
					Lus10024538 [exp]	17.6	0.7870
AT1G80270		PPR596	PENTATRICOPEPTIDE REPEAT 596 (...		Lus10031004 [exp]	19.9	0.7840
AT1G07950		MED22B	Surfeit locus protein 5 subuni...		Lus10023466 [exp]	20.0	0.7790
AT1G21770			Acyl-CoA N-acyltransferases (N...		Lus10018168 [exp]	21.8	0.7537
AT4G14615			unknown protein		Lus10041178 [exp]	28.0	0.7471

Compare expression of checked genes

Lus10018699 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.