Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59845 99 / 1e-28 Gibberellin-regulated family protein (.1) AT2G39540 95 / 4e-27 Gibberellin-regulated family protein (.1) AT2G14900 89 / 9e-25 Gibberellin-regulated family protein (.1) AT1G10588 87 / 6e-24 Gibberellin-regulated family protein (.1.2) AT1G74670 61 / 2e-13 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT2G18420 59 / 5e-13 Gibberellin-regulated family protein (.1) AT5G15230 58 / 2e-12 GASA4 GAST1 protein homolog 4 (.1.2) AT4G09600 57 / 2e-12 GASA3 GAST1 protein homolog 3 (.1) AT1G75750 57 / 3e-12 GASA1 GAST1 protein homolog 1 (.1.2) AT1G22690 56 / 2e-11 Gibberellin-regulated family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024791 [exp] 119 / 7e-37 AT5G59845 114 / 5e-35 Gibberellin-regulated family protein (.1) Lus10001407 [exp] 91 / 3e-25 AT5G59845 95 / 6e-27 Gibberellin-regulated family protein (.1) Lus10029340 [exp] 71 / 2e-17 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1) Lus10042012 [exp] 70 / 5e-17 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10018016 [exp] 69 / 1e-16 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10030680 [exp] 65 / 4e-15 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2) Lus10005241 [exp] 64 / 6e-15 ND 96 / 4e-27 Lus10004048 [exp] 64 / 1e-14 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10025962 [exp] 63 / 2e-14 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G020100 [exp] 111 / 1e-33 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1) Potri.001G297700 [exp] 102 / 5e-30 AT2G14900 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.009G092600 [exp] 101 / 8e-30 AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.001G315500 [exp] 77 / 7e-20 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1) Potri.013G113400 [exp] 69 / 7e-17 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.007G051300 [exp] 68 / 3e-16 AT2G14900 61 / 3e-13 Gibberellin-regulated family protein (.1) Potri.001G254100 [exp] 66 / 3e-15 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.006G044400 [exp] 65 / 4e-15 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.017G124200 [exp] 64 / 5e-15 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1) Potri.005G239000 [exp] 63 / 1e-14 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10018708 pacid=23176221 polypeptide=Lus10018708 locus=Lus10018708.g ID=Lus10018708.BGIv1.0 annot-version=v1.0 ATGAAGGCAACACTTCTGATCATCTCCCTTCTTCTCATCACATCCTCATCTGTTACTTCTGCTGCTTCTGGTGAGCCGTCGTGGTGTGATTCGAAGTGCG GAGTAAGGTGCTCGAAAGCAGGGGTGCAAGATAGATGCCTAAAGTACTGTGGAATTTGCTGTGAAAAATGTAACTGCGTTCCTTCTGGGACTTATGGCAA CAAGGATGAGTGTCCTTGCTACAGAGACTTGAACAACTCCAAGGGCAAACCCAAGTGCCCTTAG
AA sequence Show only first row Show all	>Lus10018708 pacid=23176221 polypeptide=Lus10018708 locus=Lus10018708.g ID=Lus10018708.BGIv1.0 annot-version=v1.0 MKATLLIISLLLITSSSVTSAASGEPSWCDSKCGVRCSKAGVQDRCLKYCGICCEKCNCVPSGTYGNKDECPCYRDLNNSKGKPKCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59845			Gibberellin-regulated family p...		Lus10018708 [exp]	0	1
AT1G49330			hydroxyproline-rich glycoprote...		Lus10015036 [exp]	6.2	0.7528
AT5G03860		MLS	malate synthase (.1.2)		Lus10006282 [exp]	7.5	0.6947
AT3G10460			Plant self-incompatibility pro...		Lus10016165 [exp]	7.9	0.7142
AT1G24460		TNO1	TGN-localized SYP41 interactin...		Lus10009250 [exp]	9.4	0.7135
AT3G22060			Receptor-like protein kinase-r...		Lus10022286 [exp]	14.0	0.6700
AT4G05120		FUR1, ENT3, FLU...	FUDR RESISTANT 1, EQUILIBRATIV...		Lus10018523 [exp]	15.5	0.7045
AT5G64667		IDL2	inflorescence deficient in abs...		Lus10005811 [exp]	19.6	0.7174
AT1G63060			unknown protein		Lus10001796 [exp]	29.4	0.6376
AT1G63060			unknown protein		Lus10002567 [exp]	29.8	0.6376
AT1G13680			PLC-like phosphodiesterases su...		Lus10035130 [exp]	34.0	0.6757

Compare expression of checked genes

Lus10018708 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.