Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66540 279 / 1e-93 Cytochrome P450 superfamily protein (.1.2) AT4G37340 280 / 7e-92 CYP81D3 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) AT4G37360 269 / 1e-87 CYP81D2 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) AT5G67310 268 / 5e-87 CYP81G1 "cytochrome P450, family 81, subfamily G, polypeptide 1", cytochrome P450, family 81, subfamily G, polypeptide 1 (.1) AT4G37370 266 / 1e-86 CYP81D8 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) AT4G37320 263 / 2e-85 CYP81D5 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) AT3G28740 262 / 6e-85 CYP81D11, CYP81D1 cytochrome P450, family 81, subfamily D, polypeptide 11, Cytochrome P450 superfamily protein (.1) AT4G37330 262 / 7e-85 CYP81D4 "cytochrome P450, family 81, subfamily D, polypeptide 4", cytochrome P450, family 81, subfamily D, polypeptide 4 (.1) AT5G36220 259 / 6e-84 CYP91A1, CYP81D1 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) AT4G37430 254 / 1e-81 CYP81F1, CYP91A2 "cytochrome P450, family 91, subfamily A, polypeptide 2", CYTOCHROME P450 MONOOXYGENASE 81F1, cytochrome P450, family 91, subfamily A, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018717 [exp] 296 / 1e-97 AT4G37370 533 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10020437 [exp] 294 / 4e-97 AT4G37370 630 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024816 [exp] 286 / 1e-93 AT4G37370 506 / 2e-176 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10018711 [exp] 270 / 7e-88 AT4G37370 441 / 5e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10027614 [exp] 267 / 1e-87 AT4G37370 496 / 6e-174 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10011958 [exp] 268 / 6e-87 AT5G36220 548 / 0.0 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10010373 [exp] 256 / 4e-83 AT4G37370 375 / 3e-126 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10041643 [exp] 251 / 5e-80 AT4G37320 433 / 6e-148 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10024078 [exp] 246 / 3e-78 AT4G37320 437 / 3e-149 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G020600 [exp] 317 / 2e-106 AT4G37370 479 / 4e-166 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121400 [exp] 317 / 2e-106 AT4G37370 470 / 1e-162 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121200 [exp] 313 / 1e-104 AT4G37340 465 / 1e-160 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) Potri.014G020500 [exp] 310 / 9e-104 AT4G37370 462 / 2e-159 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121100 [exp] 303 / 7e-101 AT4G37370 429 / 2e-146 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020432 [exp] 293 / 3e-97 AT4G37370 440 / 4e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G021700 [exp] 263 / 4e-85 AT5G10600 436 / 7e-149 "cytochrome P450, family 81, subfamily K, polypeptide 2", cytochrome P450, family 81, subfamily K, polypeptide 2 (.1) Potri.014G021800 [exp] 263 / 6e-85 AT4G37360 458 / 1e-157 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) Potri.005G143900 [exp] 258 / 1e-83 AT4G37370 511 / 5e-179 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G006000 [exp] 254 / 7e-82 AT4G37370 526 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10018712 pacid=23176189 polypeptide=Lus10018712 locus=Lus10018712.g ID=Lus10018712.BGIv1.0 annot-version=v1.0 ATGGTCAAGAGATTGGAGGTTTTGCAGTTGAAGAGAGACCGATTTATGCAGAAGTTGATTGAGGAGCGGCGGAGTATGACGGCGGCGGCGGCGGGTCAGA GCAGGACCATGGCCGATGTCCTGCTGGAGTTGCAGCAGGGAGACCCCACTTATTATACTGACGATATAATCAGAGGTTTGATGCAAGTGATGTTATCAGC GGGGACGGATACTTCAGCAGCAACCATGGAATGGACACTATCGCTTCTCCTGAACAATCCGCACACAATTGCGAGGGCCAAAGCAGAAATCGCCACCAAC GTCGGAAACGCCAAGTTGCTCGAAGAATCTGATCTTCCGAATCTGCCTTACCTCGCCGGAATCGTCAAAGAGAGTATGCGTATGTACCCCGTGGCTCCAC TTTTGGTGCCCCATGAGTCGTCGGACGAGTGTACCATTGGAGGGTTTCACGTGCAACGAGGGACGATGCTATTGGTCAACACGTGGGCTATACACCATGA TCCCAAGTTATGGGAAGATCCTGAAAAGTTCAGCCCGGAGAGATTCTTGATGGAAGGAGGAGTAGGCTGGCAGTATCTGTGGATGCCGTTTGGAACAGGG AGGAGAAGGTGCCCTGGGGAAAGTTTGGCAATGAGAGTTATTGGGTTAACTTTGGGATCTATAATTCAGTGCTTTGAATGGGGAAGGGATGGAGATGGAA TGGTGGACATGACTGAATCAAATGGACTTACTATGCCAAAGCTCCATCCTTTGTTGGCTAAATGCAGGCCATCTCCTGACATGGCCCATCACCTTTCCCT ACTCTAA
AA sequence Show only first row Show all	>Lus10018712 pacid=23176189 polypeptide=Lus10018712 locus=Lus10018712.g ID=Lus10018712.BGIv1.0 annot-version=v1.0 MVKRLEVLQLKRDRFMQKLIEERRSMTAAAAGQSRTMADVLLELQQGDPTYYTDDIIRGLMQVMLSAGTDTSAATMEWTLSLLLNNPHTIARAKAEIATN VGNAKLLEESDLPNLPYLAGIVKESMRMYPVAPLLVPHESSDECTIGGFHVQRGTMLLVNTWAIHHDPKLWEDPEKFSPERFLMEGGVGWQYLWMPFGTG RRRCPGESLAMRVIGLTLGSIIQCFEWGRDGDGMVDMTESNGLTMPKLHPLLAKCRPSPDMAHHLSLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37340		CYP81D3	"cytochrome P450, family 81, s...		Lus10018712 [exp]	0	1
AT2G23190		CYP81D7	"cytochrome P450, family 81, s...		Lus10018713 [exp]	1.0	0.7623
AT5G47840		AMK2	adenosine monophosphate kinase...		Lus10003504 [exp]	11.2	0.6511
AT1G75540	CO	LHUS, AtBBX21, ...	long hypocotyl under shade, B-...		Lus10017495 [exp]	22.4	0.6292
AT4G25490	AP2_ERF	DREB1B, CBF1, A...	DRE BINDING PROTEIN 1B, C-repe...		Lus10027414 [exp]	28.3	0.6351
AT5G50960		ATNBP35, NBP35	nucleotide binding protein 35 ...		Lus10036588 [exp]	29.6	0.5989
AT5G39050		PMAT1	phenolic glucoside malonyltran...		Lus10020721 [exp]	44.5	0.5730
AT3G50910			unknown protein		Lus10041772 [exp]	48.0	0.6324
AT1G63800		UBC5	ubiquitin-conjugating enzyme 5...		Lus10002359 [exp]	48.8	0.6165
AT3G01650		RGLG1	RING domain ligase1 (.1)		Lus10003654 [exp]	52.5	0.6140
AT5G24810			ABC1 family protein (.1.2)		Lus10026970 [exp]	62.3	0.6012

Compare expression of checked genes

Lus10018712 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.